PDB entry 5n2a

View 5n2a on RCSB PDB site
Description: methyl-coenzyme m reductase III from methanotorris formicicus trigonal form
Class: transferase
Keywords: transferase, post-translational modification, binding sites, catalysis, coenzymes, disulfides, hydrogen, hydrogen bonding, ligands, mesna, metalloporphyrins, methane, methanococcales, nickel, oxidation-reduction, oxidoreductases, phosphothreonine, protein conformation, protein folding, protein structure, thermophile, autotroph, hydroxy-tryptophane
Deposited on 2017-02-07, released 2017-06-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-06-14, with a file datestamp of 2017-06-09.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methyl-coenzyme m reductase subunit alpha
    Species: Methanotorris formicicus Mc-S-70 [TaxId:647171]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Methyl-coenzyme M reductase, beta subunit
    Species: Methanotorris formicicus Mc-S-70 [TaxId:647171]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5n2ab1, d5n2ab2
  • Chain 'C':
    Compound: Methyl-coenzyme M reductase, gamma subunit
    Species: Methanotorris formicicus Mc-S-70 [TaxId:647171]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5n2ac_
  • Heterogens: COM, TP7, F43, K, BR

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5n2aB (B:)
    mvkyedkiclynakgelveenvpleaisplynptiqklvkdikrtvavnlagienalktg
    avggkacvipgrtldlpivenaetimeyvdkllrispdddtsvklindgkqmavqlpskr
    levaaeysismlntamalkeaiiktfdvdmfdapmvhaailgrypqvpdymganiasllg
    aptnleglgyalrnimvnhyvattkknimnavafasimeqtamfemgdaigsferlhllg
    layqglnadnlvidlvkangkngtvgtvvasiveraledgvitedkkmpsgfvlykpvdv
    akwnayaaaglvaavivncgaaraaqnvastilyyndiieyetglpgvdfgraegtavgf
    sffshsiyggggpgifngnhivtrhskgfaippvcaamcvdagtqmfspektsalvgavf
    saidefreplkyvidgalavkdki
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n2aB (B:)
    vkyedkiclynakgelveenvpleaisplynptiqklvkdikrtvavnlagienalktga
    vggkacvipgrtldlpivenaetimeyvdkllrispdddtsvklindgkqmavqlpskrl
    evaaeysismlntamalkeaiiktfdvdmfdapmvhaailgrypqvpdymganiasllga
    ptnleglgyalrnimvnhyvattkknimnavafasimeqtamfemgdaigsferlhllgl
    ayqglnadnlvidlvkangkngtvgtvvasiveraledgvitedkkmpsgfvlykpvdva
    kwnayaaaglvaavivncgaaraaqnvastilyyndiieyetglpgvdfgraegtavgfs
    ffshsiyggggpgifngnhivtrhskgfaippvcaamcvdagtqmfspektsalvgavfs
    aidefreplkyvidgalavkdki
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5n2aC (C:)
    maykpqfypgetkiaqnrrnhmnpeveleklreipdedvvkimghrqpgedyktihpple
    emdlpddyvrdlvepingakeghriryiqfadsmyfapaqpydrartymwrfrgvdtgtl
    sgrqviemresdlealsknflidtaffdparcgirgatvhghslrldenglmfdalqryv
    ydektghvvyvkdqvgrpldepvdvgellpeeklreittiyrkdgvpmredkelltivkr
    ihrartlggfcptedtfkql
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n2aC (C:)
    ykpqfypgetkiaqnrrnhmnpeveleklreipdedvvkimghrqpgedyktihppleem
    dlpddyvrdlvepingakeghriryiqfadsmyfapaqpydrartymwrfrgvdtgtlsg
    rqviemresdlealsknflidtaffdparcgirgatvhghslrldenglmfdalqryvyd
    ektghvvyvkdqvgrpldepvdvgellpeeklreittiyrkdgvpmredkelltivkrih
    rartlggfcptedtfkql