PDB entry 5n28

View 5n28 on RCSB PDB site
Description: methyl-coenzyme m reductase III from methanotorris formicicus monoclinic form
Class: transferase
Keywords: transferase, post-translational modification, binding sites, catalysis, coenzymes, disulfides, hydrogen, hydrogen bonding, ligands, mesna, metalloporphyrins, methane, methanococcales, nickel, oxidation-reduction, oxidoreductases, phosphothreonine, protein conformation, protein folding, protein structure, thermophile, autotroph, hydroxy-tryptophane
Deposited on 2017-02-07, released 2017-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-14, with a file datestamp of 2017-06-09.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methyl-coenzyme m reductase subunit alpha
    Species: Methanotorris formicicus Mc-S-70 [TaxId:647171]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Methyl-coenzyme M reductase, beta subunit
    Species: Methanotorris formicicus Mc-S-70 [TaxId:647171]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5n28b1, d5n28b2
  • Chain 'C':
    Compound: Methyl-coenzyme M reductase, gamma subunit
    Species: Methanotorris formicicus Mc-S-70 [TaxId:647171]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5n28c_
  • Chain 'D':
    Compound: methyl-coenzyme m reductase subunit alpha
    Species: Methanotorris formicicus Mc-S-70 [TaxId:647171]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Methyl-coenzyme M reductase, beta subunit
    Species: Methanotorris formicicus Mc-S-70 [TaxId:647171]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5n28e1, d5n28e2
  • Chain 'F':
    Compound: Methyl-coenzyme M reductase, gamma subunit
    Species: Methanotorris formicicus Mc-S-70 [TaxId:647171]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5n28f_
  • Heterogens: COM, TP7, F43, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5n28B (B:)
    mvkyedkiclynakgelveenvpleaisplynptiqklvkdikrtvavnlagienalktg
    avggkacvipgrtldlpivenaetimeyvdkllrispdddtsvklindgkqmavqlpskr
    levaaeysismlntamalkeaiiktfdvdmfdapmvhaailgrypqvpdymganiasllg
    aptnleglgyalrnimvnhyvattkknimnavafasimeqtamfemgdaigsferlhllg
    layqglnadnlvidlvkangkngtvgtvvasiveraledgvitedkkmpsgfvlykpvdv
    akwnayaaaglvaavivncgaaraaqnvastilyyndiieyetglpgvdfgraegtavgf
    sffshsiyggggpgifngnhivtrhskgfaippvcaamcvdagtqmfspektsalvgavf
    saidefreplkyvidgalavkdki
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n28B (B:)
    vkyedkiclynakgelveenvpleaisplynptiqklvkdikrtvavnlagienalktga
    vggkacvipgrtldlpivenaetimeyvdkllrispdddtsvklindgkqmavqlpskrl
    evaaeysismlntamalkeaiiktfdvdmfdapmvhaailgrypqvpdymganiasllga
    ptnleglgyalrnimvnhyvattkknimnavafasimeqtamfemgdaigsferlhllgl
    ayqglnadnlvidlvkangkngtvgtvvasiveraledgvitedkkmpsgfvlykpvdva
    kwnayaaaglvaavivncgaaraaqnvastilyyndiieyetglpgvdfgraegtavgfs
    ffshsiyggggpgifngnhivtrhskgfaippvcaamcvdagtqmfspektsalvgavfs
    aidefreplkyvidgalavkdki
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5n28C (C:)
    maykpqfypgetkiaqnrrnhmnpeveleklreipdedvvkimghrqpgedyktihpple
    emdlpddyvrdlvepingakeghriryiqfadsmyfapaqpydrartymwrfrgvdtgtl
    sgrqviemresdlealsknflidtaffdparcgirgatvhghslrldenglmfdalqryv
    ydektghvvyvkdqvgrpldepvdvgellpeeklreittiyrkdgvpmredkelltivkr
    ihrartlggfcptedtfkql
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n28C (C:)
    ykpqfypgetkiaqnrrnhmnpeveleklreipdedvvkimghrqpgedyktihppleem
    dlpddyvrdlvepingakeghriryiqfadsmyfapaqpydrartymwrfrgvdtgtlsg
    rqviemresdlealsknflidtaffdparcgirgatvhghslrldenglmfdalqryvyd
    ektghvvyvkdqvgrpldepvdvgellpeeklreittiyrkdgvpmredkelltivkrih
    rartlggfcptedtfkql
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5n28E (E:)
    mvkyedkiclynakgelveenvpleaisplynptiqklvkdikrtvavnlagienalktg
    avggkacvipgrtldlpivenaetimeyvdkllrispdddtsvklindgkqmavqlpskr
    levaaeysismlntamalkeaiiktfdvdmfdapmvhaailgrypqvpdymganiasllg
    aptnleglgyalrnimvnhyvattkknimnavafasimeqtamfemgdaigsferlhllg
    layqglnadnlvidlvkangkngtvgtvvasiveraledgvitedkkmpsgfvlykpvdv
    akwnayaaaglvaavivncgaaraaqnvastilyyndiieyetglpgvdfgraegtavgf
    sffshsiyggggpgifngnhivtrhskgfaippvcaamcvdagtqmfspektsalvgavf
    saidefreplkyvidgalavkdki
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n28E (E:)
    vkyedkiclynakgelveenvpleaisplynptiqklvkdikrtvavnlagienalktga
    vggkacvipgrtldlpivenaetimeyvdkllrispdddtsvklindgkqmavqlpskrl
    evaaeysismlntamalkeaiiktfdvdmfdapmvhaailgrypqvpdymganiasllga
    ptnleglgyalrnimvnhyvattkknimnavafasimeqtamfemgdaigsferlhllgl
    ayqglnadnlvidlvkangkngtvgtvvasiveraledgvitedkkmpsgfvlykpvdva
    kwnayaaaglvaavivncgaaraaqnvastilyyndiieyetglpgvdfgraegtavgfs
    ffshsiyggggpgifngnhivtrhskgfaippvcaamcvdagtqmfspektsalvgavfs
    aidefreplkyvidgalavkdki
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5n28F (F:)
    maykpqfypgetkiaqnrrnhmnpeveleklreipdedvvkimghrqpgedyktihpple
    emdlpddyvrdlvepingakeghriryiqfadsmyfapaqpydrartymwrfrgvdtgtl
    sgrqviemresdlealsknflidtaffdparcgirgatvhghslrldenglmfdalqryv
    ydektghvvyvkdqvgrpldepvdvgellpeeklreittiyrkdgvpmredkelltivkr
    ihrartlggfcptedtfkql
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n28F (F:)
    ykpqfypgetkiaqnrrnhmnpeveleklreipdedvvkimghrqpgedyktihppleem
    dlpddyvrdlvepingakeghriryiqfadsmyfapaqpydrartymwrfrgvdtgtlsg
    rqviemresdlealsknflidtaffdparcgirgatvhghslrldenglmfdalqryvhv
    vyvkdqvgrpldepvdvgellpeeklreittiyrkdgvpmredkelltivkrihrartlg
    gfcptedtfkql