PDB entry 5n1q

View 5n1q on RCSB PDB site
Description: methyl-coenzyme m reductase III from methanothermococcus thermolithotrophicus at 1.9 a resolution
Class: transferase
Keywords: transferase, post-translational modification, binding sites, catalysis, coenzymes, disulfides, hydrogen, hydrogen bonding, ligands, mesna, metalloporphyrins, methane, methanococcales, nickel, oxidation-reduction, oxidoreductases, phosphothreonine, protein conformation, protein folding, protein structure, thermophile, autotroph
Deposited on 2017-02-06, released 2017-06-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-06-14, with a file datestamp of 2017-06-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methyl-coenzyme m reductase III from methanothermococcus thermolithotrophicus subunit alpha
    Species: Methanothermococcus thermolithotrophicus DSM 2095 [TaxId:523845]
    Database cross-references and differences (RAF-indexed):
    • PDB 5N1Q (Start-552)
  • Chain 'B':
    Compound: methyl-coenzyme m reductase III from methanothermococcus thermolithotrophicus subunit beta
    Species: Methanothermococcus thermolithotrophicus DSM 2095 [TaxId:523845]
    Database cross-references and differences (RAF-indexed):
    • PDB 5N1Q (Start-442)
    Domains in SCOPe 2.06: d5n1qb1, d5n1qb2
  • Chain 'C':
    Compound: methyl-coenzyme m reductase III from methanothermococcus thermolithotrophicus subunit gamma
    Species: Methanothermococcus thermolithotrophicus DSM 2095 [TaxId:523845]
    Database cross-references and differences (RAF-indexed):
    • PDB 5N1Q (Start-260)
    Domains in SCOPe 2.06: d5n1qc_
  • Chain 'D':
    Compound: methyl-coenzyme m reductase III from methanothermococcus thermolithotrophicus subunit alpha
    Species: Methanothermococcus thermolithotrophicus DSM 2095 [TaxId:523845]
    Database cross-references and differences (RAF-indexed):
    • PDB 5N1Q (Start-552)
  • Chain 'E':
    Compound: methyl-coenzyme m reductase III from methanothermococcus thermolithotrophicus subunit beta
    Species: Methanothermococcus thermolithotrophicus DSM 2095 [TaxId:523845]
    Database cross-references and differences (RAF-indexed):
    • PDB 5N1Q (Start-442)
    Domains in SCOPe 2.06: d5n1qe1, d5n1qe2
  • Chain 'F':
    Compound: methyl-coenzyme m reductase III from methanothermococcus thermolithotrophicus subunit gamma
    Species: Methanothermococcus thermolithotrophicus DSM 2095 [TaxId:523845]
    Database cross-references and differences (RAF-indexed):
    • PDB 5N1Q (Start-260)
    Domains in SCOPe 2.06: d5n1qf_
  • Heterogens: TP7, F43, K, COM, GOL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5n1qB (B:)
    mvkyedkislydakgnlvedgvpleaisplynptikamvknikrtvavnlagienslktg
    aiggkgckvpgrtldlpivenaeaimdevekilritpdddtqlraindgkqlvvqvpskr
    levaaeysvsmlntamalkeaiiktfdvdlfdgstihaaivgrypqvmdymggniasllg
    apsnmeglgyalrnimvnhyvattkknlmnavafasimeqtamfemgdaigsfermhllg
    layqglnsdnlvidlvkanskgtvgtvvasvveraledkvivedkslesgftmykpadva
    kwnayaaaglvaavivncgaaraaqnvastilyyndileyetglpgtdfgraegtavgfs
    ffshsiyggggpgiftgnhvvtrhskgfaippvcaamcadagtqmfspektsalvgavys
    aidefreplkyviegalevkdki
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n1qB (B:)
    vkyedkislydakgnlvedgvpleaisplynptikamvknikrtvavnlagienslktga
    iggkgckvpgrtldlpivenaeaimdevekilritpdddtqlraindgkqlvvqvpskrl
    evaaeysvsmlntamalkeaiiktfdvdlfdgstihaaivgrypqvmdymggniasllga
    psnmeglgyalrnimvnhyvattkknlmnavafasimeqtamfemgdaigsfermhllgl
    ayqglnsdnlvidlvkanskgtvgtvvasvveraledkvivedkslesgftmykpadvak
    wnayaaaglvaavivncgaaraaqnvastilyyndileyetglpgtdfgraegtavgfsf
    fshsiyggggpgiftgnhvvtrhskgfaippvcaamcadagtqmfspektsalvgavysa
    idefreplkyviegalevkdki
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5n1qC (C:)
    maykpqfypgatkiaqnrrdhlnpdfeleklreipdeelvkvmghrqpgedyktvhpple
    emdlpedyvrdlvepisgakeghriryiqfadsmyfapaqpydrarmymwrfrgvdtgsl
    sgrqviemresnleeisknvlmdtslfdparigmrgatvhghslrldenglmfdalqryv
    ydektghvvyvkdqvgrpldepvdvgeplpeeklreittiyrkdgvpmrddeelltvvkr
    ihrartlggympvnevfdkll
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n1qC (C:)
    aykpqfypgatkiaqnrrdhlnpdfeleklreipdeelvkvmghrqpgedyktvhpplee
    mdlpedyvrdlvepisgakeghriryiqfadsmyfapaqpydrarmymwrfrgvdtgsls
    grqviemresnleeisknvlmdtslfdparigmrgatvhghslrldenglmfdalqryvy
    dektghvvyvkdqvgrpldepvdvgeplpeeklreittiyrkdgvpmrddeelltvvkri
    hrartlggympvnevfdkll
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5n1qE (E:)
    mvkyedkislydakgnlvedgvpleaisplynptikamvknikrtvavnlagienslktg
    aiggkgckvpgrtldlpivenaeaimdevekilritpdddtqlraindgkqlvvqvpskr
    levaaeysvsmlntamalkeaiiktfdvdlfdgstihaaivgrypqvmdymggniasllg
    apsnmeglgyalrnimvnhyvattkknlmnavafasimeqtamfemgdaigsfermhllg
    layqglnsdnlvidlvkanskgtvgtvvasvveraledkvivedkslesgftmykpadva
    kwnayaaaglvaavivncgaaraaqnvastilyyndileyetglpgtdfgraegtavgfs
    ffshsiyggggpgiftgnhvvtrhskgfaippvcaamcadagtqmfspektsalvgavys
    aidefreplkyviegalevkdki
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n1qE (E:)
    vkyedkislydakgnlvedgvpleaisplynptikamvknikrtvavnlagienslktga
    iggkgckvpgrtldlpivenaeaimdevekilritpdddtqlraindgkqlvvqvpskrl
    evaaeysvsmlntamalkeaiiktfdvdlfdgstihaaivgrypqvmdymggniasllga
    psnmeglgyalrnimvnhyvattkknlmnavafasimeqtamfemgdaigsfermhllgl
    ayqglnsdnlvidlvkanskgtvgtvvasvveraledkvivedkslesgftmykpadvak
    wnayaaaglvaavivncgaaraaqnvastilyyndileyetglpgtdfgraegtavgfsf
    fshsiyggggpgiftgnhvvtrhskgfaippvcaamcadagtqmfspektsalvgavysa
    idefreplkyviegalevkdki
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5n1qF (F:)
    maykpqfypgatkiaqnrrdhlnpdfeleklreipdeelvkvmghrqpgedyktvhpple
    emdlpedyvrdlvepisgakeghriryiqfadsmyfapaqpydrarmymwrfrgvdtgsl
    sgrqviemresnleeisknvlmdtslfdparigmrgatvhghslrldenglmfdalqryv
    ydektghvvyvkdqvgrpldepvdvgeplpeeklreittiyrkdgvpmrddeelltvvkr
    ihrartlggympvnevfdkll
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n1qF (F:)
    aykpqfypgatkiaqnrrdhlnpdfeleklreipdeelvkvmghrqpgedyktvhpplee
    mdlpedyvrdlvepisgakeghriryiqfadsmyfapaqpydrarmymwrfrgvdtgsls
    grqviemresnleeisknvlmdtslfdparigmrgatvhghslrldenglmfdalqryvy
    dektghvvyvkdqvgrpldepvdvgeplpeeklreittiyrkdgvpmrddeelltvvkri
    hrartlggympvnevfdkll