PDB entry 5mzv

View 5mzv on RCSB PDB site
Description: IL-23:IL-23R:Nb22E11 complex
Class: cytokine
Keywords: cytokine, inflammation, extracellular, fibronectin type III
Deposited on 2017-02-01, released 2018-01-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-07, with a file datestamp of 2018-02-02.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interleukin-12 subunit beta
    Species: Homo sapiens [TaxId:9606]
    Gene: IL12B, NKSF2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Interleukin-23 subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: IL23A, SGRF, UNQ2498/PRO5798
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Interleukin-23 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: IL23R
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Nanobody 22E11
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MZV
    Domains in SCOPe 2.07: d5mzvd_
  • Heterogens: CL, NA, NAG, BMA, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5mzvD (D:)
    mkyllptaaagllllaaqpamaevqlvesggglvqaggslrlscaasgrtfswsavgwfr
    qapgkerefvaairwsggspyyadsvkdrftisrdnakntvylqmnslrpedtavylcge
    tslfptsrgshydtwgqgtqvtvssgsgwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mzvD (D:)
    evqlvesggglvqaggslrlscaasgrtfswsavgwfrqapgkerefvaairwsggspyy
    adsvkdrftisrdnakntvylqmnslrpedtavylcgetslfptsrgshydtwgqgtqvt
    vss