PDB entry 5mzg

View 5mzg on RCSB PDB site
Description: Crystal structure of mouse MTH1 in complex with TH588
Class: hydrolase
Keywords: Inhibitor, complex, hydrolase
Deposited on 2017-01-31, released 2018-01-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-14, with a file datestamp of 2018-02-09.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 7,8-dihydro-8-oxoguanine triphosphatase
    Species: Mus musculus [TaxId:10090]
    Gene: NUDT1, MTH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53368 (20-End)
      • expression tag (19)
    Domains in SCOPe 2.07: d5mzga1, d5mzga2
  • Chain 'B':
    Compound: 7,8-dihydro-8-oxoguanine triphosphatase
    Species: Mus musculus [TaxId:10090]
    Gene: NUDT1, MTH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mzgb_
  • Heterogens: 2GE, SO4, SCN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mzgA (A:)
    mgsshhhhhhssglvprgshmstsrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvq
    egetiedgakrelleesglsvdtlhkvghisfefvgspelmdvhifsadhvhgtptesee
    mrpqwfqldqipfadlwpddsywfplllqkkkfcghfkfqdqdtilsyslrevdsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mzgA (A:)
    hmstsrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgakrelleesgl
    svdtlhkvghisfefvgspelmdvhifsadhvhgtpteseemrpqwfqldqipfadlwpd
    dsywfplllqkkkfcghfkfqdqdtilsyslrevd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5mzgB (B:)
    mgsshhhhhhssglvprgshmstsrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvq
    egetiedgakrelleesglsvdtlhkvghisfefvgspelmdvhifsadhvhgtptesee
    mrpqwfqldqipfadlwpddsywfplllqkkkfcghfkfqdqdtilsyslrevdsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mzgB (B:)
    mstsrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgakrelleesgls
    vdtlhkvghisfefvgspelmdvhifsadhvhgtpteseemrpqwfqldqipfadlwpdd
    sywfplllqkkkfcghfkfqdqdtilsyslrev