PDB entry 5mze

View 5mze on RCSB PDB site
Description: Crystal structure of mouse MTH1 with 8-oxo-dGTP
Class: hydrolase
Keywords: substrate, complex, hydrolase
Deposited on 2017-01-31, released 2018-01-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 7,8-dihydro-8-oxoguanine triphosphatase
    Species: Mus musculus [TaxId:10090]
    Gene: NUDT1, MTH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5mzea_
  • Chain 'B':
    Compound: 7,8-dihydro-8-oxoguanine triphosphatase
    Species: Mus musculus [TaxId:10090]
    Gene: NUDT1, MTH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5mzeb_
  • Chain 'C':
    Compound: 7,8-dihydro-8-oxoguanine triphosphatase
    Species: Mus musculus [TaxId:10090]
    Gene: NUDT1, MTH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5mzec_
  • Chain 'D':
    Compound: 7,8-dihydro-8-oxoguanine triphosphatase
    Species: Mus musculus [TaxId:10090]
    Gene: NUDT1, MTH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5mzed_
  • Heterogens: CU, PEG, 8DG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mzeA (A:)
    mgsshhhhhhssglvprgshmstsrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvq
    egetiedgakrelleesglsvdtlhkvghisfefvgspelmdvhifsadhvhgtptesee
    mrpqwfqldqipfadlwpddsywfplllqkkkfcghfkfqdqdtilsyslrevdsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mzeA (A:)
    srlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgakrelleesglsvdt
    lhkvghisfefvgspelmdvhifsadhvhgtpteseemrpqwfqldqipfadlwpddsyw
    fplllqkkkfcghfkfqdqdtilsyslrevdsf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5mzeB (B:)
    mgsshhhhhhssglvprgshmstsrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvq
    egetiedgakrelleesglsvdtlhkvghisfefvgspelmdvhifsadhvhgtptesee
    mrpqwfqldqipfadlwpddsywfplllqkkkfcghfkfqdqdtilsyslrevdsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mzeB (B:)
    srlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgakrelleesglsvdt
    lhkvghisfefvgspelmdvhifsadhvhgtpteseemrpqwfqldqipfadlwpddsyw
    fplllqkkkfcghfkfqdqdtilsyslrevdsf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5mzeC (C:)
    mgsshhhhhhssglvprgshmstsrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvq
    egetiedgakrelleesglsvdtlhkvghisfefvgspelmdvhifsadhvhgtptesee
    mrpqwfqldqipfadlwpddsywfplllqkkkfcghfkfqdqdtilsyslrevdsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mzeC (C:)
    tsrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgakrelleesglsvd
    tlhkvghisfefvgspelmdvhifsadhvhgtpteseemrpqwfqldqipfadlwpddsy
    wfplllqkkkfcghfkfqdqdtilsyslrevdsf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5mzeD (D:)
    mgsshhhhhhssglvprgshmstsrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvq
    egetiedgakrelleesglsvdtlhkvghisfefvgspelmdvhifsadhvhgtptesee
    mrpqwfqldqipfadlwpddsywfplllqkkkfcghfkfqdqdtilsyslrevdsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mzeD (D:)
    tsrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgakrelleesglsvd
    tlhkvghisfefvgspelmdvhifsadhvhgtpteseemrpqwfqldqipfadlwpddsy
    wfplllqkkkfcghfkfqdqdtilsyslrevdsf