PDB entry 5mz4

View 5mz4 on RCSB PDB site
Description: crystal structure of full-lengh csfv ns3/4a
Deposited on 2017-01-30, released 2017-02-15
The last revision was dated 2017-02-15, with a file datestamp of 2017-02-10.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Genome polyprotein,Genome polyprotein
    Species: Classical swine fever virus (strain Alfort) [TaxId:11097]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19712 (20-End)
      • linker (57-60)
    • Uniprot P19712 (61-750)
      • engineered mutation (223)
  • Chain 'B':
    Compound: Genome polyprotein,Genome polyprotein
    Species: Classical swine fever virus (strain Alfort) [TaxId:11097]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19712 (20-End)
      • expression tag (15-19)
      • linker (57-60)
    • Uniprot P19712 (61-751)
      • engineered mutation (223)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5mz4A (A:)
    mashhhhhhhhhhenlyfqgskrhipvvtdiysvedhrledtthlqyapnaiktegkgsg
    sgpavckkvtehercttsimdkltaffgvmprgttprapvrfptsllkirrgletgwayt
    hqggissvdhvtcgkdllvcdtmgrtrvvcqsnnkmtdeseygvktdsgcpegarcyvfn
    peavnisgtkgamvhlqktggeftcvtasgtpaffdlknlkgwaglpifeassgrvvgrv
    kvgknedskptklmsgiqtvsksatdltemvkkittmnrgefrqitlatgagkttelprs
    vieeigrhkrvlvliplraaaesvyqymrqkhpsiafnlrigemkegdmatgityasygy
    fcqmsqpklraamveysfifldeyhcatpeqlaimgkihrfsenlrvvamtatpagtvtt
    tgqkhpieefiapevmkgedlgseyldiaglkipveemknnmlvfvptrnmaveaakklk
    akgynsgyyysgedpsnlrvvtsqspyvvvatnaiesgvtlpdldvvvdtglkcekrirl
    spkmpfivtglkrmavtigeqaqrrgrvgrvkpgryyrsqetpvgskdyhydllqaqryg
    iedginitksfremnydwslyeedslmitqleilnnlliseelpmavknimartdhpepi
    qlaynsyetqvpvlfpkirngevtdtydnytflnarklgddvppyvyatededlavellg
    ldwpdpgnqgtveagralkqvvglstaenall
    

    Sequence, based on observed residues (ATOM records):
    >5mz4A (A:)
    skrhipvvtdiysvedhrledtthlqyapgsgsgpavckkvtehercttsimdkltaffg
    vmprgttprapvrfptsllkirrgletgwaythqggissvdhvtcgkdllvcdtmgrtrv
    vcqsnnkmtdeseygvktdsgcpegarcyvfnpeavnisgtkgamvhlqktggeftcvta
    sgtpaffdlknlkgwaglpifeassgrvvgrvkvgknedskptklmsgatdltemvkkit
    tmnrgefrqitlatgagkttelprsvieeigrhkrvlvliplraaaesvyqymrqkhpsi
    afnlrigemkegdmatgityasygyfcqmsqpklraamveysfifldeyhcatpeqlaim
    gkihrfsenlrvvamtatpagtvthpieefiapeveyldiaglkipveemknnmlvfvpt
    rnmaveaakklkakgynsgyyysgedpsnlrvvtsqspyvvvatnaiesgvtlpdldvvv
    dtglkcekrirlspkmpfivtglkrmavtigeqaqrrgrvgrvkpgryyrsqetpvgskd
    yhydllqaqrygiedginitksfremnydwslyeedslmitqleilnnlliseelpmavk
    nimartdhpepiqlaynsyetqvpvlfpkirngevtdtydnytflnarklgddvppyvya
    tededlavellgldwpdpgnqgtveagralkqvvglstaenall
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5mz4B (B:)
    mashhhhhhhhhhenlyfqgskrhipvvtdiysvedhrledtthlqyapnaiktegkgsg
    sgpavckkvtehercttsimdkltaffgvmprgttprapvrfptsllkirrgletgwayt
    hqggissvdhvtcgkdllvcdtmgrtrvvcqsnnkmtdeseygvktdsgcpegarcyvfn
    peavnisgtkgamvhlqktggeftcvtasgtpaffdlknlkgwaglpifeassgrvvgrv
    kvgknedskptklmsgiqtvsksatdltemvkkittmnrgefrqitlatgagkttelprs
    vieeigrhkrvlvliplraaaesvyqymrqkhpsiafnlrigemkegdmatgityasygy
    fcqmsqpklraamveysfifldeyhcatpeqlaimgkihrfsenlrvvamtatpagtvtt
    tgqkhpieefiapevmkgedlgseyldiaglkipveemknnmlvfvptrnmaveaakklk
    akgynsgyyysgedpsnlrvvtsqspyvvvatnaiesgvtlpdldvvvdtglkcekrirl
    spkmpfivtglkrmavtigeqaqrrgrvgrvkpgryyrsqetpvgskdyhydllqaqryg
    iedginitksfremnydwslyeedslmitqleilnnlliseelpmavknimartdhpepi
    qlaynsyetqvpvlfpkirngevtdtydnytflnarklgddvppyvyatededlavellg
    ldwpdpgnqgtveagralkqvvglstaenall
    

    Sequence, based on observed residues (ATOM records):
    >5mz4B (B:)
    lyfqgskrhipvvtdiysvedhrledtthlqyapgsgsgpavckkvtehercttsimdkl
    taffgvmprgttprapvrfptsllkirrgletgwaythqggissvdhvtcgkdllvcdtm
    grtrvvcqsnnkmtdeseygvktdsgcpegarcyvfnpeavnisgtkgamvhlqktggef
    tcvtasgtpaffdlknlkgwaglpifeassgrvvgrvkvgknedskptklmsgiqltemv
    kkittmnrgefrqitlatgagkttelprsvieeigrhkrvlvliplraaaesvyqymrqk
    hpsiafnlrigemkegdmatgityasygyfcqmsqpklraamveysfifldeyhcatpeq
    laimgkihrfsenlrvvamtaieefiapevmkggseyldiaglkipveemknnmlvfvpt
    rnmaveaakklkakgynsgyyysgedpsnlrvvvatnaievvdtglkcekrirlspkmpf
    ivtglkrmavtigeqaqrrgrvyyrsqetpvgskdyhydllqaqrygiedginitksfre
    mnydwslyeedslmitqleilnnlliseelpmavknimartdhpepiqlaynsyetqvpv
    lfpkirngevtdtydnytflnarklgddvppyvyatededlavellgldwpdpgnqgtve
    agralkqvvglstaenall