PDB entry 5mz2

View 5mz2 on RCSB PDB site
Description: Rubisco from Thalassiosira antarctica
Class: photosynthesis
Keywords: photosynthesis, carbon dioxide fixation, photorespiration
Deposited on 2017-01-30, released 2018-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-14, with a file datestamp of 2018-02-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rubisco large subunit
    Species: Thalassiosira antarctica var. borealis [TaxId:555753]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MZ2
    Domains in SCOPe 2.07: d5mz2a1, d5mz2a2
  • Chain 'B':
    Compound: Rubisco large subunit
    Species: Thalassiosira antarctica var. borealis [TaxId:555753]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MZ2
    Domains in SCOPe 2.07: d5mz2b1, d5mz2b2
  • Chain 'C':
    Compound: Rubisco large subunit
    Species: Thalassiosira antarctica var. borealis [TaxId:555753]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MZ2
    Domains in SCOPe 2.07: d5mz2c1, d5mz2c2
  • Chain 'D':
    Compound: Rubisco large subunit
    Species: Thalassiosira antarctica var. borealis [TaxId:555753]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MZ2
    Domains in SCOPe 2.07: d5mz2d1, d5mz2d2
  • Chain 'E':
    Compound: Rubisco large subunit
    Species: Thalassiosira antarctica var. borealis [TaxId:555753]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MZ2
    Domains in SCOPe 2.07: d5mz2e1, d5mz2e2
  • Chain 'F':
    Compound: Rubisco large subunit
    Species: Thalassiosira antarctica var. borealis [TaxId:555753]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MZ2
    Domains in SCOPe 2.07: d5mz2f1, d5mz2f2
  • Chain 'G':
    Compound: Rubisco large subunit
    Species: Thalassiosira antarctica var. borealis [TaxId:555753]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MZ2
    Domains in SCOPe 2.07: d5mz2g1, d5mz2g2
  • Chain 'H':
    Compound: Rubisco large subunit
    Species: Thalassiosira antarctica var. borealis [TaxId:555753]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MZ2
    Domains in SCOPe 2.07: d5mz2h1, d5mz2h2
  • Chain 'I':
    Compound: Rubisco small subunit
    Species: Thalassiosira antarctica var. borealis [TaxId:555753]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MZ2 (0-138)
    Domains in SCOPe 2.07: d5mz2i_
  • Chain 'J':
    Compound: Rubisco small subunit
    Species: Thalassiosira antarctica var. borealis [TaxId:555753]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MZ2 (0-138)
    Domains in SCOPe 2.07: d5mz2j_
  • Chain 'K':
    Compound: Rubisco small subunit
    Species: Thalassiosira antarctica var. borealis [TaxId:555753]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MZ2 (0-138)
    Domains in SCOPe 2.07: d5mz2k_
  • Chain 'L':
    Compound: Rubisco small subunit
    Species: Thalassiosira antarctica var. borealis [TaxId:555753]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MZ2 (0-138)
    Domains in SCOPe 2.07: d5mz2l_
  • Chain 'M':
    Compound: Rubisco small subunit
    Species: Thalassiosira antarctica var. borealis [TaxId:555753]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MZ2 (0-138)
    Domains in SCOPe 2.07: d5mz2m_
  • Chain 'N':
    Compound: Rubisco small subunit
    Species: Thalassiosira antarctica var. borealis [TaxId:555753]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MZ2 (0-138)
    Domains in SCOPe 2.07: d5mz2n_
  • Chain 'O':
    Compound: Rubisco small subunit
    Species: Thalassiosira antarctica var. borealis [TaxId:555753]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MZ2 (0-138)
    Domains in SCOPe 2.07: d5mz2o_
  • Chain 'P':
    Compound: Rubisco small subunit
    Species: Thalassiosira antarctica var. borealis [TaxId:555753]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MZ2 (0-138)
    Domains in SCOPe 2.07: d5mz2p_
  • Heterogens: MG, CAP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mz2A (A:)
    msqsvsertriksdryesgvipyakmgywdaaysvkdtdilalfritpqpgvdpveaaaa
    vagesstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnl
    tasiignvfgfkaisalrledmriphsylxtfqgpatgiivererlnkygtpllgatvkp
    klglsgknygrvvyeglxggldflkddeninsqpfmrwrerflncleginraaaatgevk
    gsylnitaatmeevykraeyakaigsvvvmidlvmgytaiqsiaywarendmllhlhrag
    nstyarqknhginfrvickwmrmsgvdhihagtvvgklegdplmikgfydilrltelevn
    lpfgiffemdwaslrrcmpvasggihcgqmhqlihylgddvvlqfgggtighpdgiqaga
    tanrvaleamvlarnegadyfnnqvgpqilrdaaktcgplqtaldlwkdisfnytstdta
    dfaetatanr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mz2A (A:)
    svsertriksdryesgvipyakmgywdaaysvkdtdilalfritpqpgvdpveaaaavag
    esstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnltas
    iignvfgfkaisalrledmriphsylxtfqgpatgiivererlnkygtpllgatvkpklg
    lsgknygrvvyeglxggldflkddeninsqpfmrwrerflncleginraaaatgevkgsy
    lnitaatmeevykraeyakaigsvvvmidlvmgytaiqsiaywarendmllhlhragnst
    yarqknhginfrvickwmrmsgvdhihagtvvgklegdplmikgfydilrltelevnlpf
    giffemdwaslrrcmpvasggihcgqmhqlihylgddvvlqfgggtighpdgiqagatan
    rvaleamvlarnegadyfnnqvgpqilrdaaktcgplqtaldlwkdisfnytstdtadfa
    e
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5mz2B (B:)
    msqsvsertriksdryesgvipyakmgywdaaysvkdtdilalfritpqpgvdpveaaaa
    vagesstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnl
    tasiignvfgfkaisalrledmriphsylxtfqgpatgiivererlnkygtpllgatvkp
    klglsgknygrvvyeglxggldflkddeninsqpfmrwrerflncleginraaaatgevk
    gsylnitaatmeevykraeyakaigsvvvmidlvmgytaiqsiaywarendmllhlhrag
    nstyarqknhginfrvickwmrmsgvdhihagtvvgklegdplmikgfydilrltelevn
    lpfgiffemdwaslrrcmpvasggihcgqmhqlihylgddvvlqfgggtighpdgiqaga
    tanrvaleamvlarnegadyfnnqvgpqilrdaaktcgplqtaldlwkdisfnytstdta
    dfaetatanr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mz2B (B:)
    svsertriksdryesgvipyakmgywdaaysvkdtdilalfritpqpgvdpveaaaavag
    esstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnltas
    iignvfgfkaisalrledmriphsylxtfqgpatgiivererlnkygtpllgatvkpklg
    lsgknygrvvyeglxggldflkddeninsqpfmrwrerflncleginraaaatgevkgsy
    lnitaatmeevykraeyakaigsvvvmidlvmgytaiqsiaywarendmllhlhragnst
    yarqknhginfrvickwmrmsgvdhihagtvvgklegdplmikgfydilrltelevnlpf
    giffemdwaslrrcmpvasggihcgqmhqlihylgddvvlqfgggtighpdgiqagatan
    rvaleamvlarnegadyfnnqvgpqilrdaaktcgplqtaldlwkdisfnytstdtadfa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5mz2C (C:)
    msqsvsertriksdryesgvipyakmgywdaaysvkdtdilalfritpqpgvdpveaaaa
    vagesstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnl
    tasiignvfgfkaisalrledmriphsylxtfqgpatgiivererlnkygtpllgatvkp
    klglsgknygrvvyeglxggldflkddeninsqpfmrwrerflncleginraaaatgevk
    gsylnitaatmeevykraeyakaigsvvvmidlvmgytaiqsiaywarendmllhlhrag
    nstyarqknhginfrvickwmrmsgvdhihagtvvgklegdplmikgfydilrltelevn
    lpfgiffemdwaslrrcmpvasggihcgqmhqlihylgddvvlqfgggtighpdgiqaga
    tanrvaleamvlarnegadyfnnqvgpqilrdaaktcgplqtaldlwkdisfnytstdta
    dfaetatanr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mz2C (C:)
    svsertriksdryesgvipyakmgywdaaysvkdtdilalfritpqpgvdpveaaaavag
    esstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnltas
    iignvfgfkaisalrledmriphsylxtfqgpatgiivererlnkygtpllgatvkpklg
    lsgknygrvvyeglxggldflkddeninsqpfmrwrerflncleginraaaatgevkgsy
    lnitaatmeevykraeyakaigsvvvmidlvmgytaiqsiaywarendmllhlhragnst
    yarqknhginfrvickwmrmsgvdhihagtvvgklegdplmikgfydilrltelevnlpf
    giffemdwaslrrcmpvasggihcgqmhqlihylgddvvlqfgggtighpdgiqagatan
    rvaleamvlarnegadyfnnqvgpqilrdaaktcgplqtaldlwkdisfnytstdtadfa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5mz2D (D:)
    msqsvsertriksdryesgvipyakmgywdaaysvkdtdilalfritpqpgvdpveaaaa
    vagesstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnl
    tasiignvfgfkaisalrledmriphsylxtfqgpatgiivererlnkygtpllgatvkp
    klglsgknygrvvyeglxggldflkddeninsqpfmrwrerflncleginraaaatgevk
    gsylnitaatmeevykraeyakaigsvvvmidlvmgytaiqsiaywarendmllhlhrag
    nstyarqknhginfrvickwmrmsgvdhihagtvvgklegdplmikgfydilrltelevn
    lpfgiffemdwaslrrcmpvasggihcgqmhqlihylgddvvlqfgggtighpdgiqaga
    tanrvaleamvlarnegadyfnnqvgpqilrdaaktcgplqtaldlwkdisfnytstdta
    dfaetatanr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mz2D (D:)
    qsvsertriksdryesgvipyakmgywdaaysvkdtdilalfritpqpgvdpveaaaava
    gesstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnlta
    siignvfgfkaisalrledmriphsylxtfqgpatgiivererlnkygtpllgatvkpkl
    glsgknygrvvyeglxggldflkddeninsqpfmrwrerflncleginraaaatgevkgs
    ylnitaatmeevykraeyakaigsvvvmidlvmgytaiqsiaywarendmllhlhragns
    tyarqknhginfrvickwmrmsgvdhihagtvvgklegdplmikgfydilrltelevnlp
    fgiffemdwaslrrcmpvasggihcgqmhqlihylgddvvlqfgggtighpdgiqagata
    nrvaleamvlarnegadyfnnqvgpqilrdaaktcgplqtaldlwkdisfnytstdtadf
    ae
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5mz2E (E:)
    msqsvsertriksdryesgvipyakmgywdaaysvkdtdilalfritpqpgvdpveaaaa
    vagesstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnl
    tasiignvfgfkaisalrledmriphsylxtfqgpatgiivererlnkygtpllgatvkp
    klglsgknygrvvyeglxggldflkddeninsqpfmrwrerflncleginraaaatgevk
    gsylnitaatmeevykraeyakaigsvvvmidlvmgytaiqsiaywarendmllhlhrag
    nstyarqknhginfrvickwmrmsgvdhihagtvvgklegdplmikgfydilrltelevn
    lpfgiffemdwaslrrcmpvasggihcgqmhqlihylgddvvlqfgggtighpdgiqaga
    tanrvaleamvlarnegadyfnnqvgpqilrdaaktcgplqtaldlwkdisfnytstdta
    dfaetatanr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mz2E (E:)
    svsertriksdryesgvipyakmgywdaaysvkdtdilalfritpqpgvdpveaaaavag
    esstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnltas
    iignvfgfkaisalrledmriphsylxtfqgpatgiivererlnkygtpllgatvkpklg
    lsgknygrvvyeglxggldflkddeninsqpfmrwrerflncleginraaaatgevkgsy
    lnitaatmeevykraeyakaigsvvvmidlvmgytaiqsiaywarendmllhlhragnst
    yarqknhginfrvickwmrmsgvdhihagtvvgklegdplmikgfydilrltelevnlpf
    giffemdwaslrrcmpvasggihcgqmhqlihylgddvvlqfgggtighpdgiqagatan
    rvaleamvlarnegadyfnnqvgpqilrdaaktcgplqtaldlwkdisfnytstdtadfa
    e
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5mz2F (F:)
    msqsvsertriksdryesgvipyakmgywdaaysvkdtdilalfritpqpgvdpveaaaa
    vagesstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnl
    tasiignvfgfkaisalrledmriphsylxtfqgpatgiivererlnkygtpllgatvkp
    klglsgknygrvvyeglxggldflkddeninsqpfmrwrerflncleginraaaatgevk
    gsylnitaatmeevykraeyakaigsvvvmidlvmgytaiqsiaywarendmllhlhrag
    nstyarqknhginfrvickwmrmsgvdhihagtvvgklegdplmikgfydilrltelevn
    lpfgiffemdwaslrrcmpvasggihcgqmhqlihylgddvvlqfgggtighpdgiqaga
    tanrvaleamvlarnegadyfnnqvgpqilrdaaktcgplqtaldlwkdisfnytstdta
    dfaetatanr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mz2F (F:)
    svsertriksdryesgvipyakmgywdaaysvkdtdilalfritpqpgvdpveaaaavag
    esstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnltas
    iignvfgfkaisalrledmriphsylxtfqgpatgiivererlnkygtpllgatvkpklg
    lsgknygrvvyeglxggldflkddeninsqpfmrwrerflncleginraaaatgevkgsy
    lnitaatmeevykraeyakaigsvvvmidlvmgytaiqsiaywarendmllhlhragnst
    yarqknhginfrvickwmrmsgvdhihagtvvgklegdplmikgfydilrltelevnlpf
    giffemdwaslrrcmpvasggihcgqmhqlihylgddvvlqfgggtighpdgiqagatan
    rvaleamvlarnegadyfnnqvgpqilrdaaktcgplqtaldlwkdisfnytstdtadfa
    e
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5mz2G (G:)
    msqsvsertriksdryesgvipyakmgywdaaysvkdtdilalfritpqpgvdpveaaaa
    vagesstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnl
    tasiignvfgfkaisalrledmriphsylxtfqgpatgiivererlnkygtpllgatvkp
    klglsgknygrvvyeglxggldflkddeninsqpfmrwrerflncleginraaaatgevk
    gsylnitaatmeevykraeyakaigsvvvmidlvmgytaiqsiaywarendmllhlhrag
    nstyarqknhginfrvickwmrmsgvdhihagtvvgklegdplmikgfydilrltelevn
    lpfgiffemdwaslrrcmpvasggihcgqmhqlihylgddvvlqfgggtighpdgiqaga
    tanrvaleamvlarnegadyfnnqvgpqilrdaaktcgplqtaldlwkdisfnytstdta
    dfaetatanr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mz2G (G:)
    qsvsertriksdryesgvipyakmgywdaaysvkdtdilalfritpqpgvdpveaaaava
    gesstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnlta
    siignvfgfkaisalrledmriphsylxtfqgpatgiivererlnkygtpllgatvkpkl
    glsgknygrvvyeglxggldflkddeninsqpfmrwrerflncleginraaaatgevkgs
    ylnitaatmeevykraeyakaigsvvvmidlvmgytaiqsiaywarendmllhlhragns
    tyarqknhginfrvickwmrmsgvdhihagtvvgklegdplmikgfydilrltelevnlp
    fgiffemdwaslrrcmpvasggihcgqmhqlihylgddvvlqfgggtighpdgiqagata
    nrvaleamvlarnegadyfnnqvgpqilrdaaktcgplqtaldlwkdisfnytstdtadf
    a
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5mz2H (H:)
    msqsvsertriksdryesgvipyakmgywdaaysvkdtdilalfritpqpgvdpveaaaa
    vagesstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnl
    tasiignvfgfkaisalrledmriphsylxtfqgpatgiivererlnkygtpllgatvkp
    klglsgknygrvvyeglxggldflkddeninsqpfmrwrerflncleginraaaatgevk
    gsylnitaatmeevykraeyakaigsvvvmidlvmgytaiqsiaywarendmllhlhrag
    nstyarqknhginfrvickwmrmsgvdhihagtvvgklegdplmikgfydilrltelevn
    lpfgiffemdwaslrrcmpvasggihcgqmhqlihylgddvvlqfgggtighpdgiqaga
    tanrvaleamvlarnegadyfnnqvgpqilrdaaktcgplqtaldlwkdisfnytstdta
    dfaetatanr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mz2H (H:)
    svsertriksdryesgvipyakmgywdaaysvkdtdilalfritpqpgvdpveaaaavag
    esstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnltas
    iignvfgfkaisalrledmriphsylxtfqgpatgiivererlnkygtpllgatvkpklg
    lsgknygrvvyeglxggldflkddeninsqpfmrwrerflncleginraaaatgevkgsy
    lnitaatmeevykraeyakaigsvvvmidlvmgytaiqsiaywarendmllhlhragnst
    yarqknhginfrvickwmrmsgvdhihagtvvgklegdplmikgfydilrltelevnlpf
    giffemdwaslrrcmpvasggihcgqmhqlihylgddvvlqfgggtighpdgiqagatan
    rvaleamvlarnegadyfnnqvgpqilrdaaktcgplqtaldlwkdisfnytstdtadfa
    e
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5mz2I (I:)
    mrltqgcfsflpdltdqqiekqvacamsrglamnvewtddphprnnywelwglplfdikd
    patvmfelnearkscaagyirmnafdasygtescvmsfitnrpanepgfyldrtegvgrq
    ivysiksysvqanpegsry
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5mz2J (J:)
    mrltqgcfsflpdltdqqiekqvacamsrglamnvewtddphprnnywelwglplfdikd
    patvmfelnearkscaagyirmnafdasygtescvmsfitnrpanepgfyldrtegvgrq
    ivysiksysvqanpegsry
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5mz2K (K:)
    mrltqgcfsflpdltdqqiekqvacamsrglamnvewtddphprnnywelwglplfdikd
    patvmfelnearkscaagyirmnafdasygtescvmsfitnrpanepgfyldrtegvgrq
    ivysiksysvqanpegsry
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5mz2L (L:)
    mrltqgcfsflpdltdqqiekqvacamsrglamnvewtddphprnnywelwglplfdikd
    patvmfelnearkscaagyirmnafdasygtescvmsfitnrpanepgfyldrtegvgrq
    ivysiksysvqanpegsry
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5mz2M (M:)
    mrltqgcfsflpdltdqqiekqvacamsrglamnvewtddphprnnywelwglplfdikd
    patvmfelnearkscaagyirmnafdasygtescvmsfitnrpanepgfyldrtegvgrq
    ivysiksysvqanpegsry
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5mz2N (N:)
    mrltqgcfsflpdltdqqiekqvacamsrglamnvewtddphprnnywelwglplfdikd
    patvmfelnearkscaagyirmnafdasygtescvmsfitnrpanepgfyldrtegvgrq
    ivysiksysvqanpegsry
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5mz2O (O:)
    mrltqgcfsflpdltdqqiekqvacamsrglamnvewtddphprnnywelwglplfdikd
    patvmfelnearkscaagyirmnafdasygtescvmsfitnrpanepgfyldrtegvgrq
    ivysiksysvqanpegsry
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5mz2P (P:)
    mrltqgcfsflpdltdqqiekqvacamsrglamnvewtddphprnnywelwglplfdikd
    patvmfelnearkscaagyirmnafdasygtescvmsfitnrpanepgfyldrtegvgrq
    ivysiksysvqanpegsry