PDB entry 5myq

View 5myq on RCSB PDB site
Description: Crystal structure of avidin in complex with ferrocene homobiotin derivative
Class: Biotin-binding protein
Keywords: complex, biotin-binding protein
Deposited on 2017-01-27, released 2018-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-14, with a file datestamp of 2018-02-09.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701
      • conflict (33)
    Domains in SCOPe 2.07: d5myqa_
  • Chain 'B':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701
      • conflict (33)
    Domains in SCOPe 2.07: d5myqb_
  • Chain 'C':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701
      • conflict (33)
    Domains in SCOPe 2.07: d5myqc_
  • Chain 'D':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701
      • conflict (33)
    Domains in SCOPe 2.07: d5myqd_
  • Heterogens: HBF, NAG, IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5myqA (A:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtqntinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5myqA (A:)
    rkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtqntinkrtq
    ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
    rl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5myqB (B:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtqntinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5myqB (B:)
    rkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtqntinkrtq
    ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
    rl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5myqC (C:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtqntinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5myqC (C:)
    rkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtqntinkrtq
    ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
    rl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5myqD (D:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtqntinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5myqD (D:)
    rkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtqntinkrtq
    ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
    rl