PDB entry 5mxw

View 5mxw on RCSB PDB site
Description: Crystal structure of yellow lupin LLPR-10.2B protein in complex with melatonin and trans-zeatin.
Class: plant protein
Keywords: plant protein, phytohormon binding protein, PR-10 protein, melatonin
Deposited on 2017-01-25, released 2018-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Class 10 plant pathogenesis-related protein
    Species: Lupinus luteus [TaxId:3873]
    Gene: pr10.2b, Ypr10.2b
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mxwa_
  • Heterogens: UNL, NA, ML1, ZEA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mxwA (A:)
    gvftfqdeytstiapaklykalvtdadiiipkavetiqsveivegnggpgtikkltfieg
    geskyvlhkieaideanlgynysivggvglpdtiekisfetklveganggsigkvtikie
    tkgdaqpneeegkaakargdaffkaiesylsahpdy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mxwA (A:)
    gvftfqdeytstiapaklykalvtdadiiipkavetiqsveivegnggpgtikkltfieg
    geskyvlhkieaideanlgynysivggvgldtiekisfetklveganggsigkvtikiet
    kgdaqpneeegkaakargdaffkaiesylsahpdy