PDB entry 5mxu

View 5mxu on RCSB PDB site
Description: Structure of the Y503F mutant of vanillyl alcohol oxidase
Class: oxidoreductase
Keywords: vanillyl alcohol oxidase, Y503F mutant, oxidoreductase
Deposited on 2017-01-24, released 2017-07-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vanillyl-alcohol oxidase
    Species: Penicillium simplicissimum [TaxId:69488]
    Gene: VAOA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56216 (Start-559)
      • engineered mutation (502)
    Domains in SCOPe 2.08: d5mxua1, d5mxua2
  • Chain 'B':
    Compound: vanillyl-alcohol oxidase
    Species: Penicillium simplicissimum [TaxId:69488]
    Gene: VAOA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56216 (Start-559)
      • engineered mutation (502)
    Domains in SCOPe 2.08: d5mxub1, d5mxub2
  • Heterogens: FAD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mxuA (A:)
    msktqefrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdp
    hhvmdqdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvv
    ldmgknmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgna
    vergvgytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiah
    lfpygfgpyidglfsqsnmgivtkigiwlmpnprgyqsylitlpkdgdlkqavdiirplr
    lgmalqnvptirhilldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygp
    epirrvlwetikdafsaipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpng
    ahlffspiakvsgedammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliq
    krkvqwlmrtliddcaangwgefrthlafmdqimetynwnnssflrfnevlknavdpngi
    iapgksgvwpsqyshvtwkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mxuA (A:)
    efrpltlppklslsdfnefiqdiirivgsenvevisskivdgsymkpththdphhvmdqd
    yflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgknm
    nrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergvgy
    tpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpygfg
    pyidglfsqsnmgivtkigiwlmpnprgyqsylitlpkdgdlkqavdiirplrlgmalqn
    vptirhilldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygpepirrvl
    wetikdafsaipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpngahlffsp
    iakvsgedammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliqkrkvqwl
    mrtliddcaangwgefrthlafmdqimetynwnnssflrfnevlknavdpngiiapgksg
    vwpsqyshvtwkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5mxuB (B:)
    msktqefrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdp
    hhvmdqdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvv
    ldmgknmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgna
    vergvgytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiah
    lfpygfgpyidglfsqsnmgivtkigiwlmpnprgyqsylitlpkdgdlkqavdiirplr
    lgmalqnvptirhilldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygp
    epirrvlwetikdafsaipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpng
    ahlffspiakvsgedammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliq
    krkvqwlmrtliddcaangwgefrthlafmdqimetynwnnssflrfnevlknavdpngi
    iapgksgvwpsqyshvtwkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mxuB (B:)
    efrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdphhvmd
    qdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgk
    nmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergv
    gytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpyg
    fgpyidglfsqsnmgivtkigiwlmpnprgyqsylitlpkdgdlkqavdiirplrlgmal
    qnvptirhilldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygpepirr
    vlwetikdafsaipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpngahlff
    spiakvsgedammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliqkrkvq
    wlmrtliddcaangwgefrthlafmdqimetynwnnssflrfnevlknavdpngiiapgk
    sgvwpsqyshvtwkl