PDB entry 5mxr

View 5mxr on RCSB PDB site
Description: Crystal Structure of the Acquired VIM-2 Metallo-beta-Lactamase in Complex with ANT-330 Inhibitor
Class: hydrolase
Keywords: metallo-beta-lactamase fold, zinc-dependent hydrolase, PFam00753, alpha-beta-beta-alpha sandwich, hydrolase
Deposited on 2017-01-24, released 2018-03-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-04-24, with a file datestamp of 2019-04-19.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-lactamase vim-2
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: blaVIM-2, bla vim-2, bla-VIM-2, blasVIM-2, blaVIM2, blm, VIM-2, vim-2, PAERUG_P32_London_17_VIM_2_10_11_06255
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5mxra_
  • Heterogens: ZN, ACT, JTY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5mxrA (A:)
eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnrs