PDB entry 5mxb

View 5mxb on RCSB PDB site
Description: Crystal structure of yellow lupin LLPR-10.2B protein in complex with melatonin
Class: plant protein
Keywords: plant protein, phytohormon binding protein, PR-10 protein, melatonin
Deposited on 2017-01-22, released 2018-04-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Class 10 plant pathogenesis-related protein
  Species: Lupinus luteus [TaxId:3873]
  Gene: pr10.2b, Ypr10.2b
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9LLQ2 (0-154)
  Domains in SCOPe 2.08: d5mxba_
• Heterogens: UNL, ML1, NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5mxbA (A:)
  gvftfqdeytstiapaklykalvtdadiiipkavetiqsveivegnggpgtikkltfieg
  geskyvlhkieaideanlgynysivggvglpdtiekisfetklveganggsigkvtikie
  tkgdaqpneeegkaakargdaffkaiesylsahpd