PDB entry 5mwy

View 5mwy on RCSB PDB site
Description: The structure of MR in complex with eplerenone.
Class: signaling protein
Keywords: Signaling protein, Nuclear Hormone receptor, ligand complex, peptide complex
Deposited on 2017-01-20, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mineralocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C2, MCR, MLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08235 (Start-271)
      • expression tag (18-19)
      • conflict (95)
    Domains in SCOPe 2.07: d5mwya1, d5mwya2
  • Chain 'B':
    Compound: ncoa1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MWY (Start-14)
  • Heterogens: YNU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mwyA (A:)
    mhnhnhnhnhnhnggenlyfqgtpspvmvleniepeivyagydsskpdtaenllstlnrl
    agkqmiqvvkwakvlpgfknlpledqitliqyswmslssfalswrsykhtnsqflyfapd
    lvfneekmhqsamyelcqgmhqislqfvrlqltfeeytimkvllllstipkdglksqaaf
    eemrtnyikelrkmvtkspnnsgqswqrfyqltklldsmhdlvsdllefcfytfreshal
    kvefpamlveiisdqlpkvesgnakplyfhrkggslvprgsgggsggsggpqaqqksllq
    qllte
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mwyA (A:)
    yfspvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakvlpgfknlp
    ledqitliqyswmslssfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhq
    islqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvtgqswqr
    fyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdqlpkvesgnakply
    fhrk
    

  • Chain 'B':
    No sequence available.