PDB entry 5mwu

View 5mwu on RCSB PDB site
Description: Crystal structure of the periplasmic nickel-binding protein NikA from Escherichia coli in complex with Ru(bpza)(CO)2Cl
Class: metal binding protein
Keywords: Artificial metalloenzymes, chlorine insertion, chlorhydrins, bio-inspired chemistry, metal binding protein
Deposited on 2017-01-20, released 2017-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nickel-binding periplasmic protein
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: nikA, b3476, JW3441
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mwua_
  • Chain 'B':
    Compound: Nickel-binding periplasmic protein
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: nikA, b3476, JW3441
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mwub_
  • Heterogens: ACT, SO4, GOL, FE, EDT, RU, CL, 6RP, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mwuA (A:)
    aapdeittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedg
    ktwtftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqi
    tlksayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvr
    nenywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayht
    qlsqpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpy
    anlglkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeii
    qadmrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfq
    aqqgladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpel
    gnipyapiateipfeqikpvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mwuA (A:)
    apdeittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedgk
    twtftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqit
    lksayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvrn
    enywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayhtq
    lsqpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpya
    nlglkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeiiq
    admrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfqa
    qqgladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpelg
    nipyapiateipfeqikp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5mwuB (B:)
    aapdeittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedg
    ktwtftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqi
    tlksayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvr
    nenywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayht
    qlsqpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpy
    anlglkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeii
    qadmrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfq
    aqqgladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpel
    gnipyapiateipfeqikpvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mwuB (B:)
    pdeittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedgkt
    wtftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqitl
    ksayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvrne
    nywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayhtql
    sqpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpyan
    lglkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeiiqa
    dmrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfqaq
    qgladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpelgn
    ipyapiateipfeqikpv