PDB entry 5mwn

View 5mwn on RCSB PDB site
Description: Structure of the EAEC T6SS component TssK N-terminal domain in complex with llama nanobodies nbK18 and nbK27
Class: transport protein
Keywords: Type 6 secretion system component TssK N-terminal domain with llama nanobodies nbK18 and nbK27, Transport protein
Deposited on 2017-01-18, released 2017-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type VI secretion protein
    Species: Escherichia coli [TaxId:562]
    Gene: ACU81_04625
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Type VI secretion protein
    Species: Escherichia coli [TaxId:562]
    Gene: ACU81_04625
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Type VI secretion protein
    Species: Escherichia coli [TaxId:562]
    Gene: ACU81_04625
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: llama nanobody raised against TssK, nbK18
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MWN (0-End)
    Domains in SCOPe 2.07: d5mwnd1, d5mwnd2
  • Chain 'E':
    Compound: llama nanobody raised against TssK, nbK18
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MWN (0-End)
    Domains in SCOPe 2.07: d5mwne1, d5mwne2
  • Chain 'F':
    Compound: llama nanobody raised against TssK, nbK18
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MWN (0-End)
    Domains in SCOPe 2.07: d5mwnf1, d5mwnf2
  • Chain 'N':
    Compound: llama nanobody raised against TssK, nbK27
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MWN (0-End)
    Domains in SCOPe 2.07: d5mwnn_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5mwnD (D:)
    qvqlvesggglvqaggtlklscaasgsisgivvmawyrqapgkqrelvasitsggttnya
    dsvkgrftiskdnaentlylrmnslkpedtavyyckaffrrdyvgydywgqgtqvtvssh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mwnD (D:)
    qvqlvesggglvqaggtlklscaasgsisgivvmawyrqapgkqrelvasitsggttnya
    dsvkgrftiskdnaentlylrmnslkpedtavyyckaffrrdyvgydywgqgtqvtvss
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5mwnE (E:)
    qvqlvesggglvqaggtlklscaasgsisgivvmawyrqapgkqrelvasitsggttnya
    dsvkgrftiskdnaentlylrmnslkpedtavyyckaffrrdyvgydywgqgtqvtvssh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mwnE (E:)
    qvqlvesggglvqaggtlklscaasgsisgivvmawyrqapgkqrelvasitsggttnya
    dsvkgrftiskdnaentlylrmnslkpedtavyyckaffrrdyvgydywgqgtqvtvss
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5mwnF (F:)
    qvqlvesggglvqaggtlklscaasgsisgivvmawyrqapgkqrelvasitsggttnya
    dsvkgrftiskdnaentlylrmnslkpedtavyyckaffrrdyvgydywgqgtqvtvssh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mwnF (F:)
    qvqlvesggglvqaggtlklscaasgsisgivvmawyrqapgkqrelvasitsggttnya
    dsvkgrftiskdnaentlylrmnslkpedtavyyckaffrrdyvgydywgqgtqvtvssh
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5mwnN (N:)
    qvqlvesggglvqpggslrlscaasgimlgyftmawyrqapgkqrelvateisggsanya
    davkgrftisrdnarstvylqmnslkpedtavyycdariwrgtvydnisgpgtqvtvssh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mwnN (N:)
    qvqlvesggglvqpggslrlscaasgimlgyftmawyrqapgkqrelvateisggsanya
    davkgrftisrdnarstvylqmnslkpedtavyycdariwrgtvydnisgpgtqvtv