PDB entry 5mwj

View 5mwj on RCSB PDB site
Description: Structure Enabled Discovery of a Stapled Peptide Inhibitor to Target the Oncogenic Transcriptional Repressor TLE1
Class: transcription
Keywords: Transducin-like; Constrained peptide inhibitor; Transcriptional corepressor, TRANSCRIPTION
Deposited on 2017-01-18, released 2017-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transducin-like enhancer protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TLE1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04724 (9-336)
      • expression tag (1-8)
    Domains in SCOPe 2.07: d5mwja1, d5mwja2
  • Chain 'B':
    Compound: transducin-like enhancer protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TLE1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04724 (9-336)
      • expression tag (1-8)
    Domains in SCOPe 2.07: d5mwjb1, d5mwjb2
  • Heterogens: DMS, EBU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mwjA (A:)
    dyfqgamgskpaysfhvtadgqmqpvpfppdaligpgiprharqintlnhgevvcavtis
    nptrhvytggkgcvkvwdishpgnkspvsqldclnrdnyirsckllpdgctlivggeast
    lsiwdlaaptprikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfq
    ghtdgascidisndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewla
    vgmessnvevlhvnkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasi
    fqskesssvlscdisvddkyivtgsgdkkatvyeviy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mwjA (A:)
    yfqgamgskpaysfhvtqmqpvpfppdaligpgiprharqintlnhgevvcavtisnptr
    hvytggkgcvkvwdisspvsqldclnrdnyirsckllpdgctlivggeastlsiwdlpri
    kaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfqghtdgascidisn
    dgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewlavgmessnvevlhv
    nkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasifqskesssvlscd
    isvddkyivtgsgdkkatvyeviy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5mwjB (B:)
    dyfqgamgskpaysfhvtadgqmqpvpfppdaligpgiprharqintlnhgevvcavtis
    nptrhvytggkgcvkvwdishpgnkspvsqldclnrdnyirsckllpdgctlivggeast
    lsiwdlaaptprikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfq
    ghtdgascidisndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewla
    vgmessnvevlhvnkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasi
    fqskesssvlscdisvddkyivtgsgdkkatvyeviy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mwjB (B:)
    yfqgamgskpaysfhvmqpvpfppdaligpgiprharqintlnhgevvcavtisnptrhv
    ytggkgcvkvwdiskspvsqldclnrdnyirsckllpdgctlivggeastlsiwdltpri
    kaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfqghtdgascidisg
    tklwtggldntvrswdlregrqlqqhdftsqifslgycptgewlavgmessnvevlhvnk
    pdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasifqskesssvlscdis
    vddkyivtgsgdkkatvyeviy