PDB entry 5mwd

View 5mwd on RCSB PDB site
Description: Crystal structure of the BCL6 BTB-domain with compound 2
Class: transcription
Keywords: Transcription, Inhibitor
Deposited on 2017-01-18, released 2017-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B-cell lymphoma 6 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: BCL6, BCL5, LAZ3, ZBTB27, ZNF51
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41182
      • engineered mutation (4)
      • engineered mutation (63)
      • engineered mutation (80)
    Domains in SCOPe 2.07: d5mwda_
  • Heterogens: TJ3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5mwdA (A:)
sadsqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftd
qlkrnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrk
fikase

    Sequence, based on observed residues (ATOM records): (download) 
    >5mwdA (A:)
sqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdqlk
rnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkfik
as