PDB entry 5muq

View 5muq on RCSB PDB site
Description: Crystal structure of DC8E8 Fab at pH 7.0 containing a Zn atom
Class: immune system
Keywords: Fab, IMMUNE SYSTEM
Deposited on 2017-01-13, released 2018-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: XRAY
Resolution: 2.62 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MUQ (0-219)
  • Chain 'B':
    Compound: antibody kappa light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MUQ (0-218)
    Domains in SCOPe 2.07: d5muqb1, d5muqb2
  • Chain 'H':
    Compound: antibody fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MUQ (0-219)
  • Chain 'L':
    Compound: antibody kappa light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MUQ (0-218)
    Domains in SCOPe 2.07: d5muql1, d5muql2
  • Heterogens: ZN, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5muqB (B:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyyckqsfylrtfgggtkldikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvrwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5muqL (L:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyyckqsfylrtfgggtkldikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvrwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec