PDB entry 5mu9

View 5mu9 on RCSB PDB site
Description: MOA-E-64 complex
Class: sugar binding protein
Keywords: papain-like protease, E-64 inhibitor complex, lectin, calcium-binding, sugar binding protein
Deposited on 2017-01-12, released 2017-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: agglutinin
    Species: Marasmius oreades [TaxId:181124]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8X123 (Start-292)
      • engineered mutation (62)
    Domains in SCOPe 2.07: d5mu9a1, d5mu9a2
  • Heterogens: FUC, GAL, GLA, EDO, ACT, E64, CA, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mu9A (A:)
    mslrrgiyhienagvpsaidlkdgsssdgtpivgwqftpdtinwhqlwlaepipnvadtf
    tlanlfsgtymdlyngsseagtavngwqgtafttnphqlwtikkssdgtsykiqnygskt
    fvdlvngdssdgakiagwtgtwdegnphqkwyfnrmsvssaeaqaaiarnphihgtyrgy
    ildgeylvlpnatftqiwkdsglpgskwreqiydcddfaiamkaavgkwgadswkangfa
    ifcgvmlgvnkagdaahaynftltkdhadivffepqnggylndigydsymafy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mu9A (A:)
    slrrgiyhienagvpsaidlkdgsssdgtpivgwqftpdtinwhqlwlaepipnvadtft
    lanlfsgtymdlyngsseagtavngwqgtafttnphqlwtikkssdgtsykiqnygsktf
    vdlvngdssdgakiagwtgtwdegnphqkwyfnrmsvssaeaqaaiarnphihgtyrgyi
    ldgeylvlpnatftqiwkdsglpgskwreqiydcddfaiamkaavgkwgadswkangfai
    fcgvmlgvnkagdaahaynftltkdhadivffepqnggylndigydsymafy