PDB entry 5mty

View 5mty on RCSB PDB site
Description: Dibenzosuberone inhibitor 8e in complex with p38 MAPK
Class: transferase
Keywords: kinase, inhibitor, p38, complex, type 1.5, transferase
Deposited on 2017-01-11, released 2017-09-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2, SAPK2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5mtya_
  • Heterogens: HB9, BOG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mtyA (A:)
    msqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfq
    siihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcq
    kltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemt
    gyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvg
    tpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaa
    qalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mtyA (A:)
    rptfyrqelnktiwevperyqnlspvsvcaafdtktglrvavkklsrpfqsiihakrtyr
    elrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltddhvqfl
    iyqilrglkyihsadiihrdlkpsnlavnedcelkildfgtrwyrapeimlnwmhynqtv
    diwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqsltq
    mpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepvadpyd
    qsfesrdllidewksltydevisfvppp