PDB entry 5mtj

View 5mtj on RCSB PDB site
Description: Yes1-SH2 in complex with monobody Mb(Yes_1)
Class: signaling protein
Keywords: Monobody, Src homology, Signaling, signaling protein
Deposited on 2017-01-09, released 2017-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-03, with a file datestamp of 2017-04-28.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase Yes
    Species: Mus musculus [TaxId:10090]
    Gene: YES1, YES
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mtja_
  • Chain 'B':
    Compound: Monobody Mb(Yes_1)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MTJ (Start-97)
    Domains in SCOPe 2.07: d5mtjb_
  • Heterogens: SO4, CXS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mtjA (A:)
    gspadsiqaeewyfgkmgrkdaerlllnpgnqrgiflvresettkgayslsirdwdevrg
    dnvkhykirkldnggyyittraqfdtlqklvkhytehadglchklttvcptvkpqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mtjA (A:)
    qaeewyfgkmgrkdaerlllnpgnqrgiflvresettkgayslsirdwdevrgdnvkhyk
    irkldnggyyittraqfdtlqklvkhytehadglchklttvcptvkpqt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5mtjB (B:)
    gsvssvptklevvaatptslliswdapavtvdyyfitygetggnspvqeftvpgskstat
    isglkpgvdytitvyawyyyddeyymnesspisinyrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mtjB (B:)
    vssvptklevvaatptslliswdapavtvdyyfitygetggnspvqeftvpgskstatis
    glkpgvdytitvyawyyyddeyymnesspisinyrt