PDB entry 5mse

View 5mse on RCSB PDB site
Description: GFP Nuclear Transport Receptor Mutant
Class: fluorescent protein
Keywords: GFP Nuclear transport receptor, FLUORESCENT PROTEIN
Deposited on 2017-01-04, released 2018-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212
      • engineered mutation (27)
      • engineered mutation (31)
      • engineered mutation (42)
      • engineered mutation (46)
      • engineered mutation (53)
      • engineered mutation (65)
      • chromophore (67)
      • engineered mutation (73)
      • engineered mutation (80-81)
      • engineered mutation (88)
      • engineered mutation (98)
      • engineered mutation (100)
      • engineered mutation (102)
      • engineered mutation (106)
      • engineered mutation (108)
      • engineered mutation (112)
      • engineered mutation (114)
      • engineered mutation (127)
      • engineered mutation (129)
      • engineered mutation (132)
      • engineered mutation (141)
      • engineered mutation (146)
      • engineered mutation (150)
      • engineered mutation (157)
      • engineered mutation (159)
      • engineered mutation (163-165)
      • engineered mutation (167-168)
      • engineered mutation (172)
      • engineered mutation (177)
      • engineered mutation (179)
      • engineered mutation (181)
      • engineered mutation (199)
      • engineered mutation (203)
      • engineered mutation (205)
      • engineered mutation (207)
      • engineered mutation (210)
      • engineered mutation (215)
      • engineered mutation (222)
      • engineered mutation (226)
    Domains in SCOPe 2.07: d5msea_
  • Chain 'B':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212
      • engineered mutation (27)
      • engineered mutation (31)
      • engineered mutation (42)
      • engineered mutation (46)
      • engineered mutation (53)
      • engineered mutation (65)
      • chromophore (67)
      • engineered mutation (73)
      • engineered mutation (80-81)
      • engineered mutation (88)
      • engineered mutation (98)
      • engineered mutation (100)
      • engineered mutation (102)
      • engineered mutation (106)
      • engineered mutation (108)
      • engineered mutation (112)
      • engineered mutation (114)
      • engineered mutation (127)
      • engineered mutation (129)
      • engineered mutation (132)
      • engineered mutation (141)
      • engineered mutation (146)
      • engineered mutation (150)
      • engineered mutation (157)
      • engineered mutation (159)
      • engineered mutation (163-165)
      • engineered mutation (167-168)
      • engineered mutation (172)
      • engineered mutation (177)
      • engineered mutation (179)
      • engineered mutation (181)
      • engineered mutation (199)
      • engineered mutation (203)
      • engineered mutation (205)
      • engineered mutation (207)
      • engineered mutation (210)
      • engineered mutation (215)
      • engineered mutation (222)
      • engineered mutation (226)
    Domains in SCOPe 2.07: d5mseb_
  • Chain 'C':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212 (3-End)
      • engineered mutation (4)
      • engineered mutation (27)
      • engineered mutation (31)
      • engineered mutation (42)
      • engineered mutation (46)
      • engineered mutation (53)
      • engineered mutation (65)
      • chromophore (67)
      • engineered mutation (73)
      • engineered mutation (80-81)
      • engineered mutation (88)
      • engineered mutation (98)
      • engineered mutation (100)
      • engineered mutation (102)
      • engineered mutation (106)
      • engineered mutation (108)
      • engineered mutation (112)
      • engineered mutation (114)
      • engineered mutation (127)
      • engineered mutation (129)
      • engineered mutation (132)
      • engineered mutation (141)
      • engineered mutation (146)
      • engineered mutation (150)
      • engineered mutation (157)
      • engineered mutation (159)
      • engineered mutation (163-165)
      • engineered mutation (167-168)
      • engineered mutation (172)
      • engineered mutation (177)
      • engineered mutation (179)
      • engineered mutation (181)
      • engineered mutation (199)
      • engineered mutation (203)
      • engineered mutation (205)
      • engineered mutation (207)
      • engineered mutation (210)
      • engineered mutation (215)
      • engineered mutation (222)
      • engineered mutation (226)
    Domains in SCOPe 2.07: d5msec_
  • Chain 'D':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212
      • engineered mutation (27)
      • engineered mutation (31)
      • engineered mutation (42)
      • engineered mutation (46)
      • engineered mutation (53)
      • engineered mutation (65)
      • chromophore (67)
      • engineered mutation (73)
      • engineered mutation (80-81)
      • engineered mutation (88)
      • engineered mutation (98)
      • engineered mutation (100)
      • engineered mutation (102)
      • engineered mutation (106)
      • engineered mutation (108)
      • engineered mutation (112)
      • engineered mutation (114)
      • engineered mutation (127)
      • engineered mutation (129)
      • engineered mutation (132)
      • engineered mutation (141)
      • engineered mutation (146)
      • engineered mutation (150)
      • engineered mutation (157)
      • engineered mutation (159)
      • engineered mutation (163-165)
      • engineered mutation (167-168)
      • engineered mutation (172)
      • engineered mutation (177)
      • engineered mutation (179)
      • engineered mutation (181)
      • engineered mutation (199)
      • engineered mutation (203)
      • engineered mutation (205)
      • engineered mutation (207)
      • engineered mutation (210)
      • engineered mutation (215)
      • engineered mutation (222)
      • engineered mutation (226)
    Domains in SCOPe 2.07: d5msed_
  • Heterogens: NA, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mseA (A:)
    agtsrgeelftgvvpilveldgdvnghrfsvrgegegdatygmltlrficttgrlpvpwp
    tlvttlgygvqcfarypdhmrrhdffkstmpegyvqermiyfeddgayrtravvrfegdt
    lvnrielrgtdfredgnilghrleynfnshmvyimadrqrngiramfntrhnvedgseqv
    amhyqqntpigdgpvllpddhylytmsllsvdpnerrdhmvlrefvmaagitlgmdelyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mseA (A:)
    geelftgvvpilveldgdvnghrfsvrgegegdatygmltlrficttgrlpvpwptlvtt
    lgygvqcfarypdhmrrhdffkstmpegyvqermiyfeddgayrtravvrfegdtlvnri
    elrgtdfredgnilghrleynfnshmvyimadrqrngiramfntrhnvedgseqvamhyq
    qntpigdgpvllpddhylytmsllsvdpnerrdhmvlrefvmaagi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5mseB (B:)
    agtsrgeelftgvvpilveldgdvnghrfsvrgegegdatygmltlrficttgrlpvpwp
    tlvttlgygvqcfarypdhmrrhdffkstmpegyvqermiyfeddgayrtravvrfegdt
    lvnrielrgtdfredgnilghrleynfnshmvyimadrqrngiramfntrhnvedgseqv
    amhyqqntpigdgpvllpddhylytmsllsvdpnerrdhmvlrefvmaagitlgmdelyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mseB (B:)
    geelftgvvpilveldgdvnghrfsvrgegegdatygmltlrficttgrlpvpwptlvtt
    lgygvqcfarypdhmrrhdffkstmpegyvqermiyfeddgayrtravvrfegdtlvnri
    elrgtdfredgnilghrleynfnshmvyimadrqrngiramfntrhnvedgseqvamhyq
    qntpigdgpvllpddhylytmsllsvdpnerrdhmvlrefvmaagi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5mseC (C:)
    agtsrgeelftgvvpilveldgdvnghrfsvrgegegdatygmltlrficttgrlpvpwp
    tlvttlgygvqcfarypdhmrrhdffkstmpegyvqermiyfeddgayrtravvrfegdt
    lvnrielrgtdfredgnilghrleynfnshmvyimadrqrngiramfntrhnvedgseqv
    amhyqqntpigdgpvllpddhylytmsllsvdpnerrdhmvlrefvmaagitlgmdelyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mseC (C:)
    srgeelftgvvpilveldgdvnghrfsvrgegegdatygmltlrficttgrlpvpwptlv
    ttlgygvqcfarypdhmrrhdffkstmpegyvqermiyfeddgayrtravvrfegdtlvn
    rielrgtdfredgnilghrleynfnshmvyimadrqrngiramfntrhnvedgseqvamh
    yqqntpigdgpvllpddhylytmsllsvdpnerrdhmvlrefvmaagit
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5mseD (D:)
    agtsrgeelftgvvpilveldgdvnghrfsvrgegegdatygmltlrficttgrlpvpwp
    tlvttlgygvqcfarypdhmrrhdffkstmpegyvqermiyfeddgayrtravvrfegdt
    lvnrielrgtdfredgnilghrleynfnshmvyimadrqrngiramfntrhnvedgseqv
    amhyqqntpigdgpvllpddhylytmsllsvdpnerrdhmvlrefvmaagitlgmdelyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mseD (D:)
    geelftgvvpilveldgdvnghrfsvrgegegdatygmltlrficttgrlpvpwptlvtt
    lgygvqcfarypdhmrrhdffkstmpegyvqermiyfeddgayrtravvrfegdtlvnri
    elrgtdfredgnilghrleynfnshmvyimadrqrngiramfntrhnvedgseqvamhyq
    qntpigdgpvllpddhylytmsllsvdpnerrdhmvlrefvmaagi