PDB entry 5mrq

View 5mrq on RCSB PDB site
Description: Arabidopsis thaliana IspD Asp262Ala Mutant
Class: transferase
Keywords: herbicide, anti-infectives, drug discovery, mutant, transferase
Deposited on 2016-12-23, released 2017-07-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-07-19, with a file datestamp of 2017-07-14.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ISPD, MCT, MECT, MEPCT, At2g02500, T8K22.20
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69834
      • conflict (74)
      • engineered mutation (187)
    Domains in SCOPe 2.06: d5mrqa_
  • Heterogens: TRS, CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mrqA (A:)
    meksvsvillaggqgkrmkmsmpkqyipllgqpialysfftfsrmpevkeivvvcdpffr
    difeeyeesidvdlsfaipgkerqdsvysglqeidvnselvcihdsarplvntedvekvl
    kdgsavgaavlgvpakatikevnsdslvvktldrktlwemqtpqvikpellkkgfelvks
    eglevtdavsiveylkhpvyvsqgsytnikvttpddlllaerilseds
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mrqA (A:)
    ksvsvillagmpkqyipllgqpialysfftfsrmpevkeivvvcdpffrdifeeyeesid
    vdlsfaipgkerqdsvysglqeidvnselvcihdsarplvntedvekvlkdgsavgaavl
    gvpakatikevnsdslvvktldrktlwemqtpqvikpellkkgfelvkseglevtdavsi
    veylkhpvyvsqgsytnikvttpddlllaerils