PDB entry 5mr1

View 5mr1 on RCSB PDB site
Description: Crystal structure of the Pleckstrin homology domain of Interactor protein for cytohesin exchange factors 1 (IPCEF1)
Class: signaling protein
Keywords: cytohesin, scaffold protien, Pleckstrin homology, PIP3E, signaling protein
Deposited on 2016-12-21, released 2017-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-01-11, with a file datestamp of 2017-01-06.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Interactor protein for cytohesin exchange factors 1
  Species: Homo sapiens [TaxId:9606]
  Gene: IPCEF1, KIAA0403
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8WWN9 (2-102)
  Domains in SCOPe 2.06: d5mr1a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >5mr1A (A:)
  smadcqgwlykkkekgsflsnkwkkfwvilkgsslywysnqmaekadgfvnlpdftvera
  seckkkhafkishpqiktfyfaaenvqemnvwlnklgsavihq
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >5mr1A (A:)
  adcqgwlykkkekgsflsnkwkkfwvilkgsslywysnqmaekadgfvnlpdftverase
  ckkkhafkishpqiktfyfaaenvqemnvwlnklgsavihq