PDB entry 5mqy

View 5mqy on RCSB PDB site
Description: CATHEPSIN L IN COMPLEX WITH 4-[1,3-benzodioxol-5-ylmethyl(2-phenoxyethyl)amino]-5-fluoropyrimidine-2-carbonitrile
Class: hydrolase
Keywords: protease inhibitor, hydrolase-hydrolase inhibitor complex, hydrolase
Deposited on 2016-12-21, released 2017-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-07, with a file datestamp of 2017-06-02.
Experiment type: XRAY
Resolution: 1.13 Å
R-factor: N/A
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cathepsin L1
    Species: Homo sapiens [TaxId:9606]
    Gene: CTSL, CTSL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mqya_
  • Heterogens: GH4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mqyA (A:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn
    kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mqyA (A:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestnkywl
    vknswgeewgmggyvkmakdrrnhcgiasaasyptv