PDB entry 5mqv

View 5mqv on RCSB PDB site
Description: Crystal structure of human Casein Kinase I delta in complex with 4-(2,5-Dimethoxyphenyl)-N-(4-(5-(4-fluorphenyl)-2-(methylthio)-1H-imidazol-4-yl)-pyridin-2-yl)-1-methyl-1H-pyrrole-2-carboxamide
Class: transferase
Keywords: CK1D, Kinase-inhibitor complex, transferase, Kinase
Deposited on 2016-12-20, released 2017-04-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-04-05, with a file datestamp of 2017-03-31.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Casein kinase I isoform delta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1D, HCKID
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5mqva_
  • Chain 'B':
    Compound: Casein kinase I isoform delta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1D, HCKID
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5mqvb_
  • Chain 'C':
    Compound: Casein kinase I isoform delta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1D, HCKID
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5mqvc_
  • Chain 'D':
    Compound: Casein kinase I isoform delta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1D, HCKID
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5mqvd_
  • Chain 'E':
    Compound: Casein kinase I isoform delta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1D, HCKID
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5mqve_
  • Chain 'F':
    Compound: Casein kinase I isoform delta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1D, HCKID
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5mqvf_
  • Heterogens: D5Q, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mqvA (A:)
    mgsshhhhhhssglvprgshmelrvgnryrlgrkigsgsfgdiylgtdiaageevaikle
    cvktkhpqlhieskiykmmqggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkf
    slktvllladqmisrieyihsknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdar
    thqhipyrenknltgtaryasinthlgieqsrrddleslgyvlmyfnlgslpwqglkaat
    krqkyerisekkmstpievlckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrq
    gfsydyvfdwnmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mqvA (A:)
    ryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmqggvgipt
    irwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknfihr
    dvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasinthlg
    ieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckgypse
    fatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5mqvB (B:)
    mgsshhhhhhssglvprgshmelrvgnryrlgrkigsgsfgdiylgtdiaageevaikle
    cvktkhpqlhieskiykmmqggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkf
    slktvllladqmisrieyihsknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdar
    thqhipyrenknltgtaryasinthlgieqsrrddleslgyvlmyfnlgslpwqglkaat
    krqkyerisekkmstpievlckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrq
    gfsydyvfdwnmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mqvB (B:)
    ryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmqggvgipt
    irwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknfihr
    dvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasinthlg
    ieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckgypse
    fatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5mqvC (C:)
    mgsshhhhhhssglvprgshmelrvgnryrlgrkigsgsfgdiylgtdiaageevaikle
    cvktkhpqlhieskiykmmqggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkf
    slktvllladqmisrieyihsknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdar
    thqhipyrenknltgtaryasinthlgieqsrrddleslgyvlmyfnlgslpwqglkaat
    krqkyerisekkmstpievlckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrq
    gfsydyvfdwnmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mqvC (C:)
    gnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmqggvgi
    ptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknfi
    hrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasinth
    lgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckgyp
    sefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnml
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5mqvD (D:)
    mgsshhhhhhssglvprgshmelrvgnryrlgrkigsgsfgdiylgtdiaageevaikle
    cvktkhpqlhieskiykmmqggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkf
    slktvllladqmisrieyihsknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdar
    thqhipyrenknltgtaryasinthlgieqsrrddleslgyvlmyfnlgslpwqglkaat
    krqkyerisekkmstpievlckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrq
    gfsydyvfdwnmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mqvD (D:)
    ryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmqggvgipt
    irwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknfihr
    dvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasinthlg
    ieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckgypse
    fatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5mqvE (E:)
    mgsshhhhhhssglvprgshmelrvgnryrlgrkigsgsfgdiylgtdiaageevaikle
    cvktkhpqlhieskiykmmqggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkf
    slktvllladqmisrieyihsknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdar
    thqhipyrenknltgtaryasinthlgieqsrrddleslgyvlmyfnlgslpwqglkaat
    krqkyerisekkmstpievlckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrq
    gfsydyvfdwnmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mqvE (E:)
    ryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmqggvgipt
    irwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknfihr
    dvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasinthlg
    ieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckgypse
    fatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5mqvF (F:)
    mgsshhhhhhssglvprgshmelrvgnryrlgrkigsgsfgdiylgtdiaageevaikle
    cvktkhpqlhieskiykmmqggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkf
    slktvllladqmisrieyihsknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdar
    thqhipyrenknltgtaryasinthlgieqsrrddleslgyvlmyfnlgslpwqglkaat
    krqkyerisekkmstpievlckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrq
    gfsydyvfdwnmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mqvF (F:)
    nryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmqggvgip
    tirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknfih
    rdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasinthl
    gieqsrrddleslgyvlmyfnlgslpwqglatkrqkyerisekkmstpievlckgypsef
    atylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk