PDB entry 5mp4

View 5mp4 on RCSB PDB site
Description: The structure of Pst2p from Saccharomyces cerevisiae
Class: oxidoreductase
Keywords: oxidoreductase, FMN binding, flavodoxin-like, quinone reduction
Deposited on 2016-12-15, released 2017-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protoplast secreted protein 2
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: PST2, YDR032C, D3422, YD9673.02C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mp4a_
  • Chain 'B':
    Compound: Protoplast secreted protein 2
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: PST2, YDR032C, D3422, YD9673.02C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mp4b_
  • Chain 'C':
    Compound: Protoplast secreted protein 2
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: PST2, YDR032C, D3422, YD9673.02C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mp4c_
  • Chain 'D':
    Compound: Protoplast secreted protein 2
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: PST2, YDR032C, D3422, YD9673.02C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mp4d_
  • Chain 'E':
    Compound: Protoplast secreted protein 2
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: PST2, YDR032C, D3422, YD9673.02C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mp4e_
  • Chain 'F':
    Compound: Protoplast secreted protein 2
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: PST2, YDR032C, D3422, YD9673.02C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mp4f_
  • Chain 'G':
    Compound: Protoplast secreted protein 2
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: PST2, YDR032C, D3422, YD9673.02C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mp4g_
  • Chain 'H':
    Compound: Protoplast secreted protein 2
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: PST2, YDR032C, D3422, YD9673.02C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mp4h_
  • Heterogens: PO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mp4A (A:)
    mprvaiiiytlyghvaataeaekkgieaaggsadiyqveetlspevvkalggapkpdypi
    atqdtlteydaflfgiptrfgnfpaqwkafwdrtgglwakgalhgkvagcfvstgtgggn
    eatimnslstlahhgiifvplgyknvfaeltnmdevhggspwgagtiagsdgsrspsale
    lqvheiqgktfyetvakf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mp4A (A:)
    prvaiiiytlyghvaataeaekkgieaaggsadiyqveetlspevvkalggapkpdypia
    tqdtlteydaflfgiptrfgnfpaqwkafwdrtgglwakgalhgkvagcfvstgtgggne
    atimnslstlahhgiifvplgyknvfaeltnmdevhggspwgagtiagsdgsrspsalel
    qvheiqgktfyetvakf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5mp4B (B:)
    mprvaiiiytlyghvaataeaekkgieaaggsadiyqveetlspevvkalggapkpdypi
    atqdtlteydaflfgiptrfgnfpaqwkafwdrtgglwakgalhgkvagcfvstgtgggn
    eatimnslstlahhgiifvplgyknvfaeltnmdevhggspwgagtiagsdgsrspsale
    lqvheiqgktfyetvakf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mp4B (B:)
    prvaiiiytlyghvaataeaekkgieaaggsadiyqveetlspevvkalggapkpdypia
    tqdtlteydaflfgiptrfgnfpaqwkafwdrtgglwakgalhgkvagcfvstgtgggne
    atimnslstlahhgiifvplgyknvfaeltnmdevhggspwgagtiagsdgsrspsalel
    qvheiqgktfyetvakf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5mp4C (C:)
    mprvaiiiytlyghvaataeaekkgieaaggsadiyqveetlspevvkalggapkpdypi
    atqdtlteydaflfgiptrfgnfpaqwkafwdrtgglwakgalhgkvagcfvstgtgggn
    eatimnslstlahhgiifvplgyknvfaeltnmdevhggspwgagtiagsdgsrspsale
    lqvheiqgktfyetvakf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mp4C (C:)
    prvaiiiytlyghvaataeaekkgieaaggsadiyqveetlspevvkalggapkpdypia
    tqdtlteydaflfgiptrfgnfpaqwkafwdrtgglwakgalhgkvagcfvstgtgggne
    atimnslstlahhgiifvplgyknvfaeltnmdevhggspwgagtiagsdgsrspsalel
    qvheiqgktfyetvakf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5mp4D (D:)
    mprvaiiiytlyghvaataeaekkgieaaggsadiyqveetlspevvkalggapkpdypi
    atqdtlteydaflfgiptrfgnfpaqwkafwdrtgglwakgalhgkvagcfvstgtgggn
    eatimnslstlahhgiifvplgyknvfaeltnmdevhggspwgagtiagsdgsrspsale
    lqvheiqgktfyetvakf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mp4D (D:)
    prvaiiiytlyghvaataeaekkgieaaggsadiyqveetlspevvkalggapkpdypia
    tqdtlteydaflfgiptrfgnfpaqwkafwdrtgglwakgalhgkvagcfvstgtgggne
    atimnslstlahhgiifvplgyknvfaeltnmdevhggspwgagtiagsdgsrspsalel
    qvheiqgktfyetvakf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5mp4E (E:)
    mprvaiiiytlyghvaataeaekkgieaaggsadiyqveetlspevvkalggapkpdypi
    atqdtlteydaflfgiptrfgnfpaqwkafwdrtgglwakgalhgkvagcfvstgtgggn
    eatimnslstlahhgiifvplgyknvfaeltnmdevhggspwgagtiagsdgsrspsale
    lqvheiqgktfyetvakf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mp4E (E:)
    prvaiiiytlyghvaataeaekkgieaaggsadiyqveetlspevvkalggapkpdypia
    tqdtlteydaflfgiptrfgnfpaqwkafwdrtgglwakgalhgkvagcfvstgtgggne
    atimnslstlahhgiifvplgyknvfaeltnmdevhggspwgagtiagsdgsrspsalel
    qvheiqgktfyetvakf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5mp4F (F:)
    mprvaiiiytlyghvaataeaekkgieaaggsadiyqveetlspevvkalggapkpdypi
    atqdtlteydaflfgiptrfgnfpaqwkafwdrtgglwakgalhgkvagcfvstgtgggn
    eatimnslstlahhgiifvplgyknvfaeltnmdevhggspwgagtiagsdgsrspsale
    lqvheiqgktfyetvakf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mp4F (F:)
    prvaiiiytlyghvaataeaekkgieaaggsadiyqveetlspevvkalggapkpdypia
    tqdtlteydaflfgiptrfgnfpaqwkafwdrtgglwakgalhgkvagcfvstgtgggne
    atimnslstlahhgiifvplgyknvfaeltnmdevhggspwgagtiagsdgsrspsalel
    qvheiqgktfyetvakf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5mp4G (G:)
    mprvaiiiytlyghvaataeaekkgieaaggsadiyqveetlspevvkalggapkpdypi
    atqdtlteydaflfgiptrfgnfpaqwkafwdrtgglwakgalhgkvagcfvstgtgggn
    eatimnslstlahhgiifvplgyknvfaeltnmdevhggspwgagtiagsdgsrspsale
    lqvheiqgktfyetvakf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mp4G (G:)
    prvaiiiytlyghvaataeaekkgieaaggsadiyqveetlspevvkalggapkpdypia
    tqdtlteydaflfgiptrfgnfpaqwkafwdrtgglwakgalhgkvagcfvstgtgggne
    atimnslstlahhgiifvplgyknvfaeltnmdevhggspwgagtiagsdgsrspsalel
    qvheiqgktfyetvakf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5mp4H (H:)
    mprvaiiiytlyghvaataeaekkgieaaggsadiyqveetlspevvkalggapkpdypi
    atqdtlteydaflfgiptrfgnfpaqwkafwdrtgglwakgalhgkvagcfvstgtgggn
    eatimnslstlahhgiifvplgyknvfaeltnmdevhggspwgagtiagsdgsrspsale
    lqvheiqgktfyetvakf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mp4H (H:)
    prvaiiiytlyghvaataeaekkgieaaggsadiyqveetlspevvkalggapkpdypia
    tqdtlteydaflfgiptrfgnfpaqwkafwdrtgglwakgalhgkvagcfvstgtgggne
    atimnslstlahhgiifvplgyknvfaeltnmdevhggspwgagtiagsdgsrspsalel
    qvheiqgktfyetvakf