PDB entry 5mny

View 5mny on RCSB PDB site
Description: Neutron structure of cationic trypsin in complex with aniline
Class: hydrolase
Keywords: hydrogen bonding, protonation, protein-ligand interaction, hydrolase
Deposited on 2016-12-13, released 2017-05-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-11-14, with a file datestamp of 2018-11-09.
Experiment type: NEUT
Resolution: 1.43 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5mnya_
  • Heterogens: CA, WOT, DOD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5mnyA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn