PDB entry 5mnv

View 5mnv on RCSB PDB site
Description: Structural and functional characterization of OleP in complex with 6DEB in PEG
Class: oxidoreductase
Keywords: P450, Cytochrome, 6DEB, epoxidase, oxidoreductase
Deposited on 2016-12-13, released 2018-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-28, with a file datestamp of 2018-02-23.
Experiment type: XRAY
Resolution: 2.97 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P-450
    Species: Streptomyces antibioticus [TaxId:1890]
    Gene: oleP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mnva_
  • Chain 'B':
    Compound: Cytochrome P-450
    Species: Streptomyces antibioticus [TaxId:1890]
    Gene: oleP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mnvb_
  • Chain 'C':
    Compound: Cytochrome P-450
    Species: Streptomyces antibioticus [TaxId:1890]
    Gene: oleP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mnvc_
  • Chain 'D':
    Compound: Cytochrome P-450
    Species: Streptomyces antibioticus [TaxId:1890]
    Gene: oleP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mnvd_
  • Chain 'E':
    Compound: Cytochrome P-450
    Species: Streptomyces antibioticus [TaxId:1890]
    Gene: oleP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mnve_
  • Chain 'F':
    Compound: Cytochrome P-450
    Species: Streptomyces antibioticus [TaxId:1890]
    Gene: oleP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mnvf_
  • Chain 'G':
    Compound: Cytochrome P-450
    Species: Streptomyces antibioticus [TaxId:1890]
    Gene: oleP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mnvg_
  • Chain 'H':
    Compound: Cytochrome P-450
    Species: Streptomyces antibioticus [TaxId:1890]
    Gene: oleP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mnvh_
  • Chain 'I':
    Compound: Cytochrome P-450
    Species: Streptomyces antibioticus [TaxId:1890]
    Gene: oleP
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HEM, DEB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mnvA (A:)
    mtdthtgptpadavpaypfslphaldldphyaelrrdepvsrvrlpygegtawlvtrmsd
    arivlgdsrfstaaatdpatprmfptppepdgvlaqdppdhtrlrrlvgkaftarrveem
    rprvrslvdsllddmvahgspadlveflavpfpvavicellgvpledrdlfrtfsdamls
    strltaaeiqrvqqdfmvymdglvaqrrdaptedllgalalatdnddhltkgeivnmgvs
    lliaghetsvnqitnlvhlllterkryeslvadpalvpaaveemlrytplvsagsfvrva
    tedvelstvtvragepcvvhfasanrdeevfdhadeldfhrernphiafghgahhcigaq
    lgrlelqealsalvrrfptldlaepvaglkwkqgmlirglerqivsw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mnvA (A:)
    adavpaypfslphaldldphyaelrrdepvsrvrlpygegtawlvtrmsdarivlgdsrf
    staaatdpatprmfptppepdgvlaqdppdhtrlrrlvgkaftarrveemrprvrslvds
    llddmvahgspadlveflavpfpvavicellgvpledrdlfrtfsdamlsstrltaaeiq
    rvqqdfmvymdglvaqrrdaptedllgalalatdnddhltkgeivnmgvslliaghetsv
    nqitnlvhlllterkryeslvadpalvpaaveemlrytplvsagsfvrvatedvelstvt
    vragepcvvhfasanrdeevfdhadeldfhrernphiafghgahhcigaqlgrlelqeal
    salvrrfptldlaepvaglkwkqgmlirglerqivsw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5mnvB (B:)
    mtdthtgptpadavpaypfslphaldldphyaelrrdepvsrvrlpygegtawlvtrmsd
    arivlgdsrfstaaatdpatprmfptppepdgvlaqdppdhtrlrrlvgkaftarrveem
    rprvrslvdsllddmvahgspadlveflavpfpvavicellgvpledrdlfrtfsdamls
    strltaaeiqrvqqdfmvymdglvaqrrdaptedllgalalatdnddhltkgeivnmgvs
    lliaghetsvnqitnlvhlllterkryeslvadpalvpaaveemlrytplvsagsfvrva
    tedvelstvtvragepcvvhfasanrdeevfdhadeldfhrernphiafghgahhcigaq
    lgrlelqealsalvrrfptldlaepvaglkwkqgmlirglerqivsw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mnvB (B:)
    vpaypfslphaldldphyaelrrdepvsrvrlpygegtawlvtrmsdarivlgdsrfsta
    aatdpatprmfptppepdgvlaqdppdhtrlrrlvgkaftarrveemrprvrslvdslld
    dmvahgspadlveflavpfpvavicellgvpledrdlfrtfsdamlsstrltaaeiqrvq
    qdfmvymdglvaqrrdaptedllgalalatdnddhltkgeivnmgvslliaghetsvnqi
    tnlvhlllterkryeslvadpalvpaaveemlrytplvsagsfvrvatedvelstvtvra
    gepcvvhfasanrdeevfdhadeldfhrernphiafghgahhcigaqlgrlelqealsal
    vrrfptldlaepvaglkwkqgmlirglerqivsw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5mnvC (C:)
    mtdthtgptpadavpaypfslphaldldphyaelrrdepvsrvrlpygegtawlvtrmsd
    arivlgdsrfstaaatdpatprmfptppepdgvlaqdppdhtrlrrlvgkaftarrveem
    rprvrslvdsllddmvahgspadlveflavpfpvavicellgvpledrdlfrtfsdamls
    strltaaeiqrvqqdfmvymdglvaqrrdaptedllgalalatdnddhltkgeivnmgvs
    lliaghetsvnqitnlvhlllterkryeslvadpalvpaaveemlrytplvsagsfvrva
    tedvelstvtvragepcvvhfasanrdeevfdhadeldfhrernphiafghgahhcigaq
    lgrlelqealsalvrrfptldlaepvaglkwkqgmlirglerqivsw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mnvC (C:)
    davpaypfslphaldldphyaelrrdepvsrvrlpygegtawlvtrmsdarivlgdsrfs
    taaatdpatprmfptppepdgvlaqdppdhtrlrrlvgkaftarrveemrprvrslvdsl
    lddmvahgspadlveflavpfpvavicellgvpledrdlfrtfsdamlsstrltaaeiqr
    vqqdfmvymdglvaqrrdaptedllgalalatdnddhltkgeivnmgvslliaghetsvn
    qitnlvhlllterkryeslvadpalvpaaveemlrytplvsagsfvrvatedvelstvtv
    ragepcvvhfasanrdeevfdhadeldfhrernphiafghgahhcigaqlgrlelqeals
    alvrrfptldlaepvaglkwkqgmlirglerqivsw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5mnvD (D:)
    mtdthtgptpadavpaypfslphaldldphyaelrrdepvsrvrlpygegtawlvtrmsd
    arivlgdsrfstaaatdpatprmfptppepdgvlaqdppdhtrlrrlvgkaftarrveem
    rprvrslvdsllddmvahgspadlveflavpfpvavicellgvpledrdlfrtfsdamls
    strltaaeiqrvqqdfmvymdglvaqrrdaptedllgalalatdnddhltkgeivnmgvs
    lliaghetsvnqitnlvhlllterkryeslvadpalvpaaveemlrytplvsagsfvrva
    tedvelstvtvragepcvvhfasanrdeevfdhadeldfhrernphiafghgahhcigaq
    lgrlelqealsalvrrfptldlaepvaglkwkqgmlirglerqivsw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mnvD (D:)
    vpaypfslphaldldphyaelrrdepvsrvrlpygegtawlvtrmsdarivlgdsrfsta
    aatdpatprmfptppepdgvlaqdppdhtrlrrlvgkaftarrveemrprvrslvdslld
    dmvahgspadlveflavpfpvavicellgvpledrdlfrtfsdamlsstrltaaeiqrvq
    qdfmvymdglvaqrrdaptedllgalalatdnddhltkgeivnmgvslliaghetsvnqi
    tnlvhlllterkryeslvadpalvpaaveemlrytplvsagsfvrvatedvelstvtvra
    gepcvvhfasanrdeevfdhadeldfhrernphiafghgahhcigaqlgrlelqealsal
    vrrfptldlaepvaglkwkqgmlirglerqivsw
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5mnvE (E:)
    mtdthtgptpadavpaypfslphaldldphyaelrrdepvsrvrlpygegtawlvtrmsd
    arivlgdsrfstaaatdpatprmfptppepdgvlaqdppdhtrlrrlvgkaftarrveem
    rprvrslvdsllddmvahgspadlveflavpfpvavicellgvpledrdlfrtfsdamls
    strltaaeiqrvqqdfmvymdglvaqrrdaptedllgalalatdnddhltkgeivnmgvs
    lliaghetsvnqitnlvhlllterkryeslvadpalvpaaveemlrytplvsagsfvrva
    tedvelstvtvragepcvvhfasanrdeevfdhadeldfhrernphiafghgahhcigaq
    lgrlelqealsalvrrfptldlaepvaglkwkqgmlirglerqivsw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mnvE (E:)
    avpaypfslphaldldphyaelrrdepvsrvrlpygegtawlvtrmsdarivlgdsrfst
    aaatdpatprmfptppepdgvlaqdppdhtrlrrlvgkaftarrveemrprvrslvdsll
    ddmvahgspadlveflavpfpvavicellgvpledrdlfrtfsdamlsstraaeiqrvqq
    dfmvymdglvaqrrdaptedllgalalnddhltkgeivnmgvslliaghetsvnqitnlv
    hlllterkryeslvadpalvpaaveemlrytplvsagsfvrvatedvelstvtvragepc
    vvhfasanrdeevfdhadeldfhrernphiafghgahhcigaqlgrlelqealsalvrrf
    ptldlaepvaglkwkqgmlirglerqivsw
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5mnvF (F:)
    mtdthtgptpadavpaypfslphaldldphyaelrrdepvsrvrlpygegtawlvtrmsd
    arivlgdsrfstaaatdpatprmfptppepdgvlaqdppdhtrlrrlvgkaftarrveem
    rprvrslvdsllddmvahgspadlveflavpfpvavicellgvpledrdlfrtfsdamls
    strltaaeiqrvqqdfmvymdglvaqrrdaptedllgalalatdnddhltkgeivnmgvs
    lliaghetsvnqitnlvhlllterkryeslvadpalvpaaveemlrytplvsagsfvrva
    tedvelstvtvragepcvvhfasanrdeevfdhadeldfhrernphiafghgahhcigaq
    lgrlelqealsalvrrfptldlaepvaglkwkqgmlirglerqivsw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mnvF (F:)
    avpaypfslphaldldphyaelrrdepvsrvrlpygegtawlvtrmsdarivlgdsrfst
    aaatdpatprmfptppepdgvlaqdppdhtrlrrlvgkaftarrveemrprvrslvdsll
    ddmvahgspadlveflavpfpvavicellgvpledrdlfrtfsdamlsstrltaaeiqrv
    qqdfmvymdglvaqrrdaptedllgalalatdnddhltkgeivnmgvslliaghetsvnq
    itnlvhlllterkryeslvadpalvpaaveemlrytplvsagsfvrvatedvelstvtvr
    agepcvvhfasanrdeevfdhadeldfhrernphiafghgahhcigaqlgrlelqealsa
    lvrrfptldlaepvaglkwkqgmlirglerqivsw
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5mnvG (G:)
    mtdthtgptpadavpaypfslphaldldphyaelrrdepvsrvrlpygegtawlvtrmsd
    arivlgdsrfstaaatdpatprmfptppepdgvlaqdppdhtrlrrlvgkaftarrveem
    rprvrslvdsllddmvahgspadlveflavpfpvavicellgvpledrdlfrtfsdamls
    strltaaeiqrvqqdfmvymdglvaqrrdaptedllgalalatdnddhltkgeivnmgvs
    lliaghetsvnqitnlvhlllterkryeslvadpalvpaaveemlrytplvsagsfvrva
    tedvelstvtvragepcvvhfasanrdeevfdhadeldfhrernphiafghgahhcigaq
    lgrlelqealsalvrrfptldlaepvaglkwkqgmlirglerqivsw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mnvG (G:)
    avpaypfslphaldldphyaelrrdepvsrvrlpygegtawlvtrmsdarivlgdsrfst
    aaatdpatprmfptppepdgvlaqdppdhtrlrrlvgkaftarrveemrprvrslvdsll
    ddmvahgspadlveflavpfpvavicellgvpledrdlfrtfsdamlsrvqqdfmvymdg
    lvaqrrdaptedllgalalatdtkgeivnmgvslliaghetsvnqitnlvhlllterkry
    eslvadpalvpaaveemlrytplvsagsfvrvatedvelstvtvragepcvvhfasanrd
    eevfdhadeldfhrernphiafghgahhcigaqlgrlelqealsalvrrfptldlaepva
    glkwkqgmlirglerqivsw
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5mnvH (H:)
    mtdthtgptpadavpaypfslphaldldphyaelrrdepvsrvrlpygegtawlvtrmsd
    arivlgdsrfstaaatdpatprmfptppepdgvlaqdppdhtrlrrlvgkaftarrveem
    rprvrslvdsllddmvahgspadlveflavpfpvavicellgvpledrdlfrtfsdamls
    strltaaeiqrvqqdfmvymdglvaqrrdaptedllgalalatdnddhltkgeivnmgvs
    lliaghetsvnqitnlvhlllterkryeslvadpalvpaaveemlrytplvsagsfvrva
    tedvelstvtvragepcvvhfasanrdeevfdhadeldfhrernphiafghgahhcigaq
    lgrlelqealsalvrrfptldlaepvaglkwkqgmlirglerqivsw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mnvH (H:)
    avpaypfslphaldldphyaelrrdepvsrvrlpygegtawlvtrmsdarivlgdsrfst
    aaatdpatprmfptppepdgvlaqdppdhtrlrrlvgkaftarrveemrprvrslvdsll
    ddmvahgspadlveflavpfpvavicellgvpledrdlfrtfsdamlsstrltaaeiqrv
    qqdfmvymdglvaqrrdaptedllgalalatdnddhltkgeivnmgvslliaghetsvnq
    itnlvhlllterkryeslvadpalvpaaveemlrytplvsagsfvrvatedvelstvtvr
    agepcvvhfasanrdeevfdhadeldfhrernphiafghgahhcigaqlgrlelqealsa
    lvrrfptldlaepvaglkwkqgmlirglerqivsw
    

  • Chain 'I':
    No sequence available.