PDB entry 5mns

View 5mns on RCSB PDB site
Description: Structural and functional characterization of OleP in complex with 6DEB in sodium formate
Class: oxidoreductase
Keywords: P450, cytochrome, 6DEB, epoxidase, oxidoreductase
Deposited on 2016-12-13, released 2018-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-28, with a file datestamp of 2018-02-23.
Experiment type: XRAY
Resolution: 2.62 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P-450
    Species: Streptomyces antibioticus [TaxId:1890]
    Gene: oleP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mnsa_
  • Chain 'B':
    Compound: Cytochrome P-450
    Species: Streptomyces antibioticus [TaxId:1890]
    Gene: oleP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mnsb_
  • Chain 'C':
    Compound: Cytochrome P-450
    Species: Streptomyces antibioticus [TaxId:1890]
    Gene: oleP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mnsc_
  • Chain 'D':
    Compound: Cytochrome P-450
    Species: Streptomyces antibioticus [TaxId:1890]
    Gene: oleP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mnsd_
  • Chain 'E':
    Compound: Cytochrome P-450
    Species: Streptomyces antibioticus [TaxId:1890]
    Gene: oleP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mnse_
  • Chain 'F':
    Compound: Cytochrome P-450
    Species: Streptomyces antibioticus [TaxId:1890]
    Gene: oleP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mnsf_
  • Heterogens: HEM, DEB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mnsA (A:)
    mtdthtgptpadavpaypfslphaldldphyaelrrdepvsrvrlpygegtawlvtrmsd
    arivlgdsrfstaaatdpatprmfptppepdgvlaqdppdhtrlrrlvgkaftarrveem
    rprvrslvdsllddmvahgspadlveflavpfpvavicellgvpledrdlfrtfsdamls
    strltaaeiqrvqqdfmvymdglvaqrrdaptedllgalalatdnddhltkgeivnmgvs
    lliaghetsvnqitnlvhlllterkryeslvadpalvpaaveemlrytplvsagsfvrva
    tedvelstvtvragepcvvhfasanrdeevfdhadeldfhrernphiafghgahhcigaq
    lgrlelqealsalvrrfptldlaepvaglkwkqgmlirglerqivsw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mnsA (A:)
    avpaypfslphaldldphyaelrrdepvsrvrlpygegtawlvtrmsdarivlgdsrfst
    aaatdpatprmfptppepdgvlaqdppdhtrlrrlvgkaftarrveemrprvrslvdsll
    ddmvahgspadlveflavpfpvavicellgvpledrdlfrtfsdamlsstrltaaeiqrv
    qqdfmvymdglvaqrrdaptedllgalalatdnddhltkgeivnmgvslliaghetsvnq
    itnlvhlllterkryeslvadpalvpaaveemlrytplvsagsfvrvatedvelstvtvr
    agepcvvhfasanrdeevfdhadeldfhrernphiafghgahhcigaqlgrlelqealsa
    lvrrfptldlaepvaglkwkqgmlirglerqivsw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5mnsB (B:)
    mtdthtgptpadavpaypfslphaldldphyaelrrdepvsrvrlpygegtawlvtrmsd
    arivlgdsrfstaaatdpatprmfptppepdgvlaqdppdhtrlrrlvgkaftarrveem
    rprvrslvdsllddmvahgspadlveflavpfpvavicellgvpledrdlfrtfsdamls
    strltaaeiqrvqqdfmvymdglvaqrrdaptedllgalalatdnddhltkgeivnmgvs
    lliaghetsvnqitnlvhlllterkryeslvadpalvpaaveemlrytplvsagsfvrva
    tedvelstvtvragepcvvhfasanrdeevfdhadeldfhrernphiafghgahhcigaq
    lgrlelqealsalvrrfptldlaepvaglkwkqgmlirglerqivsw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mnsB (B:)
    avpaypfslphaldldphyaelrrdepvsrvrlpygegtawlvtrmsdarivlgdsrfst
    aaatdpatprmfptppepdgvlaqdppdhtrlrrlvgkaftarrveemrprvrslvdsll
    ddmvahgspadlveflavpfpvavicellgvpledrdlfrtfsdamlsstrltaaeiqrv
    qqdfmvymdglvaqrrdaptedllgalalatdnddhltkgeivnmgvslliaghetsvnq
    itnlvhlllterkryeslvadpalvpaaveemlrytplvsagsfvrvatedvelstvtvr
    agepcvvhfasanrdeevfdhadeldfhrernphiafghgahhcigaqlgrlelqealsa
    lvrrfptldlaepvaglkwkqgmlirglerqivsw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5mnsC (C:)
    mtdthtgptpadavpaypfslphaldldphyaelrrdepvsrvrlpygegtawlvtrmsd
    arivlgdsrfstaaatdpatprmfptppepdgvlaqdppdhtrlrrlvgkaftarrveem
    rprvrslvdsllddmvahgspadlveflavpfpvavicellgvpledrdlfrtfsdamls
    strltaaeiqrvqqdfmvymdglvaqrrdaptedllgalalatdnddhltkgeivnmgvs
    lliaghetsvnqitnlvhlllterkryeslvadpalvpaaveemlrytplvsagsfvrva
    tedvelstvtvragepcvvhfasanrdeevfdhadeldfhrernphiafghgahhcigaq
    lgrlelqealsalvrrfptldlaepvaglkwkqgmlirglerqivsw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mnsC (C:)
    avpaypfslphaldldphyaelrrdepvsrvrlpygegtawlvtrmsdarivlgdsrfst
    aaatdpatprmfptppepdgvlaqdppdhtrlrrlvgkaftarrveemrprvrslvdsll
    ddmvahgspadlveflavpfpvavicellgvpledrdlfrtfsdamlsstrltaaeiqrv
    qqdfmvymdglvaqrrdaptedllgalalatdnddhltkgeivnmgvslliaghetsvnq
    itnlvhlllterkryeslvadpalvpaaveemlrytplvsagsfvrvatedvelstvtvr
    agepcvvhfasanrdeevfdhadeldfhrernphiafghgahhcigaqlgrlelqealsa
    lvrrfptldlaepvaglkwkqgmlirglerqivsw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5mnsD (D:)
    mtdthtgptpadavpaypfslphaldldphyaelrrdepvsrvrlpygegtawlvtrmsd
    arivlgdsrfstaaatdpatprmfptppepdgvlaqdppdhtrlrrlvgkaftarrveem
    rprvrslvdsllddmvahgspadlveflavpfpvavicellgvpledrdlfrtfsdamls
    strltaaeiqrvqqdfmvymdglvaqrrdaptedllgalalatdnddhltkgeivnmgvs
    lliaghetsvnqitnlvhlllterkryeslvadpalvpaaveemlrytplvsagsfvrva
    tedvelstvtvragepcvvhfasanrdeevfdhadeldfhrernphiafghgahhcigaq
    lgrlelqealsalvrrfptldlaepvaglkwkqgmlirglerqivsw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mnsD (D:)
    avpaypfslphaldldphyaelrrdepvsrvrlpygegtawlvtrmsdarivlgdsrfst
    aaatdpatprmfptppepdgvlaqdppdhtrlrrlvgkaftarrveemrprvrslvdsll
    ddmvahgspadlveflavpfpvavicellgvpledrdlfrtfsdamlsstrltaaeiqrv
    qqdfmvymdglvaqrrdaptedllgalalatdnddhltkgeivnmgvslliaghetsvnq
    itnlvhlllterkryeslvadpalvpaaveemlrytplvsagsfvrvatedvelstvtvr
    agepcvvhfasanrdeevfdhadeldfhrernphiafghgahhcigaqlgrlelqealsa
    lvrrfptldlaepvaglkwkqgmlirglerqivsw
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5mnsE (E:)
    mtdthtgptpadavpaypfslphaldldphyaelrrdepvsrvrlpygegtawlvtrmsd
    arivlgdsrfstaaatdpatprmfptppepdgvlaqdppdhtrlrrlvgkaftarrveem
    rprvrslvdsllddmvahgspadlveflavpfpvavicellgvpledrdlfrtfsdamls
    strltaaeiqrvqqdfmvymdglvaqrrdaptedllgalalatdnddhltkgeivnmgvs
    lliaghetsvnqitnlvhlllterkryeslvadpalvpaaveemlrytplvsagsfvrva
    tedvelstvtvragepcvvhfasanrdeevfdhadeldfhrernphiafghgahhcigaq
    lgrlelqealsalvrrfptldlaepvaglkwkqgmlirglerqivsw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mnsE (E:)
    avpaypfslphaldldphyaelrrdepvsrvrlpygegtawlvtrmsdarivlgdsrfst
    aaatdpatprmfptppepdgvlaqdppdhtrlrrlvgkaftarrveemrprvrslvdsll
    ddmvahgspadlveflavpfpvavicellgvpledrdlfrtfsdamlsstrltaaeiqrv
    qqdfmvymdglvaqrrdaptedllgalalatdnddhltkgeivnmgvslliaghetsvnq
    itnlvhlllterkryeslvadpalvpaaveemlrytplvsagsfvrvatedvelstvtvr
    agepcvvhfasanrdeevfdhadeldfhrernphiafghgahhcigaqlgrlelqealsa
    lvrrfptldlaepvaglkwkqgmlirglerqivsw
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5mnsF (F:)
    mtdthtgptpadavpaypfslphaldldphyaelrrdepvsrvrlpygegtawlvtrmsd
    arivlgdsrfstaaatdpatprmfptppepdgvlaqdppdhtrlrrlvgkaftarrveem
    rprvrslvdsllddmvahgspadlveflavpfpvavicellgvpledrdlfrtfsdamls
    strltaaeiqrvqqdfmvymdglvaqrrdaptedllgalalatdnddhltkgeivnmgvs
    lliaghetsvnqitnlvhlllterkryeslvadpalvpaaveemlrytplvsagsfvrva
    tedvelstvtvragepcvvhfasanrdeevfdhadeldfhrernphiafghgahhcigaq
    lgrlelqealsalvrrfptldlaepvaglkwkqgmlirglerqivsw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mnsF (F:)
    avpaypfslphaldldphyaelrrdepvsrvrlpygegtawlvtrmsdarivlgdsrfst
    aaatdpatprmfptppepdgvlaqdppdhtrlrrlvgkaftarrveemrprvrslvdsll
    ddmvahgspadlveflavpfpvavicellgvpledrdlfrtfsdamlsstrltaaeiqrv
    qqdfmvymdglvaqrrdaptedllgalalatdnddhltkgeivnmgvslliaghetsvnq
    itnlvhlllterkryeslvaalvpaaveemlrytplvsagsfvrvatedvelstvtvrag
    epcvvhfasanrdeevfdhadeldfhrernphiafghgahhcigaqlgrlelqealsalv
    rrfptldlaepvaglkwkqgmlirglerqivsw