PDB entry 5mnk

View 5mnk on RCSB PDB site
Description: Cationic trypsin in complex with benzylamine (deuterated sample at 100 K)
Class: hydrolase
Keywords: hydrogen bonding, protonation, protein-ligand interaction, Hydrolase
Deposited on 2016-12-13, released 2018-01-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-17, with a file datestamp of 2018-01-12.
Experiment type: XRAY
Resolution: 0.8 Å
R-factor: N/A
AEROSPACI score: 1.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5mnka_
  • Heterogens: CA, ABN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5mnkA (A:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn