PDB entry 5mn5

View 5mn5 on RCSB PDB site
Description: S. aureus FtsZ 12-316 T66W GTP Closed form (2TCm)
Class: hydrolase
Keywords: bacterial cell division, bacterial cytoskeleton, filamentous, gtpase, hydrolase
Deposited on 2016-12-12, released 2016-12-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division protein ftsz
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: ftsZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5mn5a1, d5mn5a2
  • Chain 'B':
    Compound: cell division protein ftsz
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: ftsZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5mn5b1, d5mn5b2
  • Heterogens: GTP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mn5A (A:)
    atlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigeklwrglga
    ganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvgv
    vtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvlr
    qgvqgisdliavsgevnldfadvktimsnqgsalmgigvssgenraveaakkaissplle
    tsivgaqgvlmnitggeslslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtvi
    atgfd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mn5A (A:)
    tlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqignpeigkkaae
    esreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvgvvtrpfsfegrkr
    qtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvlrqgvqgisdliav
    sgevnldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmn
    itggeslslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5mn5B (B:)
    atlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigeklwrglga
    ganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvgv
    vtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvlr
    qgvqgisdliavsgevnldfadvktimsnqgsalmgigvssgenraveaakkaissplle
    tsivgaqgvlmnitggeslslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtvi
    atgfd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mn5B (B:)
    tlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqignpeigkkaae
    esreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvgvvtrpfsfegrkr
    qtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvlrqgvqgisdlial
    dfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgges
    lslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgf