PDB entry 5mn1

View 5mn1 on RCSB PDB site
Description: Cationic trypsin in complex with 2-aminopyridine (deuterated sample at 100 K)
Class: hydrolase
Keywords: hydrogen bonding, protonation, protein-ligand interaction, hydrolase
Deposited on 2016-12-12, released 2017-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-24, with a file datestamp of 2017-05-19.
Experiment type: XRAY
Resolution: 0.79 Å
R-factor: N/A
AEROSPACI score: 1.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mn1a_
  • Heterogens: CA, SO4, 2AP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5mn1A (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn