PDB entry 5mmd

View 5mmd on RCSB PDB site
Description: TMB-1. Structural insights into TMB-1 and the role of residue 119 and 228 in substrate and inhibitor binding
Class: hydrolase
Keywords: Metallo-beta-lactamase, TMB-1, TMB-2, Thermal stability, enzyme kinetics, mutants, HYDROLASE
Deposited on 2016-12-09, released 2017-03-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Metallo-beta-lactamase 1
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: blaTMB-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5mmde_
  • Chain 'F':
    Compound: Metallo-beta-lactamase 1
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: blaTMB-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5mmdf_
  • Heterogens: ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5mmdE (E:)
    gneeipgleveeidngvflhksysrvegwglvssnglvvisggkafiidtpwsesdtekl
    vdwirskkyelagsisthshedktagikwlngksittyasaltneilkregkeqarssfk
    gnefslmdgflevyypggghtidnlvvwipsskilyggcfirslessglgytgeakidqw
    pqsarntiskypeakivvpghgkigdfellkhtkvlaekasnkanhgdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mmdE (E:)
    eipgleveeidngvflhksysrvegwglvssnglvvisggkafiidtpwsesdteklvdw
    irskkyelagsisthshedktagikwlngksittyasaltneilkregkeqarssfkgne
    fslmdgflevyypggghtidnlvvwipsskilyggcfirslessglgytgeakidqwpqs
    arntiskypeakivvpghgkigdfellkhtkvlaekasnka
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5mmdF (F:)
    gneeipgleveeidngvflhksysrvegwglvssnglvvisggkafiidtpwsesdtekl
    vdwirskkyelagsisthshedktagikwlngksittyasaltneilkregkeqarssfk
    gnefslmdgflevyypggghtidnlvvwipsskilyggcfirslessglgytgeakidqw
    pqsarntiskypeakivvpghgkigdfellkhtkvlaekasnkanhgdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mmdF (F:)
    ipgleveeidngvflhksysrvegwglvssnglvvisggkafiidtpwsesdteklvdwi
    rskkyelagsisthshedktagikwlngksittyasaltneilkregkeqarssfkgnef
    slmdgflevyypggghtidnlvvwipsskilyggcfirslessglgytgeakidqwpqsa
    rntiskypeakivvpghgkigdfellkhtkvlaekasn