PDB entry 5mm8

View 5mm8 on RCSB PDB site
Description: Atomic resolution structure of SplE protease from Staphylococcus aureus
Class: hydrolase
Keywords: Protease, Staphylococcus aureus, virulence, HYDROLASE
Deposited on 2016-12-08, released 2018-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine protease SplE
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: splE, SAUSA300_1754
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2FFT3 (2-203)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d5mm8a1, d5mm8a2
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mm8A (A:)
    gsehnvklikntnvapyngvvsigsgtgfivgkntivtnkhvvagmeigahiiahpngey
    nnggfykvkkivrysgqediailhvedkavhpknrnfkdytgilkiaseakenerisivg
    ypepyinkfqmyestgkvlsvkgnmiitdafvepgnsgsavfnskyevvgvhfggngpgn
    kstkgygvyfspeikkfiadntdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mm8A (A:)
    gsehnvklikntnvapyngvvsigsgtgfivgkntivtnkhvvagmeigahiiahpngey
    nnggfykvkkivrysgqediailhvedkavhpknrnfkdytgilkiaseakenerisivg
    ypepyinkfqmyestgkvlsvkgnmiitdafvepgnsgsavfnskyevvgvhfggstkgy
    gvyfspeikkfiadntdk