PDB entry 5ml5

View 5ml5 on RCSB PDB site
Description: Human p38alpha MAPK in complex with imidazolyl pyridine inhibitor 11b
Class: transferase
Keywords: kinase, p38alpha, inhibitor, complex, CK1, transferase
Deposited on 2016-12-06, released 2017-04-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-04-05, with a file datestamp of 2017-03-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2, SAPK2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ml5a_
  • Heterogens: BOG, 1VI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ml5A (A:)
    msqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfq
    siihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcq
    kltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemt
    gyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvg
    tpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaa
    qalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ml5A (A:)
    rptfyrqelnktiwevperyqnlspvgsygsvcaafdtktglrvavkklsrpfqsiihak
    rtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltddh
    vqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfgtrwyrapeimlnwmhy
    nqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiq
    sltfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepvadpydqs
    fesrdllidewksltydevisfvppp