PDB entry 5mky

View 5mky on RCSB PDB site
Description: BROMODOMAIN OF HUMAN BRD9 WITH 4-chloro-2-methyl-5-((2-methyl-1,2,3,4-tetrahydroisoquinolin-5-yl)amino)pyridazin-3(2H)-one
Class: transcription
Keywords: brd9, inhibitor, histone, epigenetic reader, bromodomain, transcription
Deposited on 2016-12-05, released 2017-12-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 9
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD9, UNQ3040/PRO9856
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5mkya_
  • Heterogens: I0D, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mkyA (A:)
    gaenestpiqqllehflrqlqrkdphgffafpvtdaiapgysmiikhpmdfgtmkdkiva
    neyksvtefkadfklmcdnamtynrpdtvyyklakkilhagfkmms
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mkyA (A:)
    stpiqqllehflrqlqrkdphgffafpvtdaiapgysmiikhpmdfgtmkdkivaneyks
    vtefkadfklmcdnamtynrpdtvyyklakkilhagfkmms