PDB entry 5mk8

View 5mk8 on RCSB PDB site
Description: Crystal structure of the receptor-binding domain of the FA hybrid Clostridium botulinum neurotoxin
Class: toxin
Keywords: bacterial toxin Toxin receptor binding domain jelly roll fold beta trefoil fold, TOXIN
Deposited on 2016-12-02, released 2018-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Botulinum neurotoxin FA binding domain
    Species: Clostridium botulinum [TaxId:1491]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MK8 (Start-436)
    Domains in SCOPe 2.07: d5mk8a1, d5mk8a2
  • Chain 'B':
    Compound: Botulinum neurotoxin FA binding domain
    Species: Clostridium botulinum [TaxId:1491]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MK8
    Domains in SCOPe 2.07: d5mk8b1, d5mk8b2
  • Heterogens: FMT, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mk8A (A:)
    mhhhhhhgelkyncilnikyemdrdklvdssgyrsrinigtgvkfseidknqvqlsnles
    skievilnngviynsmyenfstsfwiripkyfrninneykiiscmqnnsgwevslnfsnm
    nskiiwtlqdtegikktvvfqytqninisdyinrwifvtitnnrlsnskiyingrlinee
    sisdlgnihasnnimfkldgcrdphryiwikyfnlfdkelnkkeikdlydnqsnsgilkd
    fwgdylqydkpyymlnlydpnkyldvnnvgirgymylkgprgrivttniylnstlymgtk
    fiikkyasgnkdnivrnndrvyinvvvknkeyrlatnasqagvekilsaveipdvgnlsq
    vvvmksendqgirnkckmnlqdnngndigfigfhqfnniaklvasnwynrqigkasrtfg
    cswefipvddgwgessl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mk8A (A:)
    kyncilnikyemdrdklvdssgyrsrinigtgvkfseidknqvqlsnlesskievilnng
    viynsmyenfstsfwiripkyfrninneykiiscmqnnsgwevslnfsnmnskiiwtlqd
    tegikktvvfqytqninisdyinrwifvtitnnrlsnskiyingrlineesisdlgniha
    snnimfkldgcrdphryiwikyfnlfdkelnkkeikdlydnqsnsgilkdfwgdylqydk
    pyymlnlydpnkyldvnnvgirgymylkgprgrivttniylnstlymgtkfiikkyasgn
    kdnivrnndrvyinvvvknkeyrlatnasqagvekilsaveipdvgnlsqvvvmksenkc
    kmnlqdnngndigfigfhqfnniaklvasnwynrqigkasrtfgcswefipvddgwgess
    l
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5mk8B (B:)
    mhhhhhhgelkyncilnikyemdrdklvdssgyrsrinigtgvkfseidknqvqlsnles
    skievilnngviynsmyenfstsfwiripkyfrninneykiiscmqnnsgwevslnfsnm
    nskiiwtlqdtegikktvvfqytqninisdyinrwifvtitnnrlsnskiyingrlinee
    sisdlgnihasnnimfkldgcrdphryiwikyfnlfdkelnkkeikdlydnqsnsgilkd
    fwgdylqydkpyymlnlydpnkyldvnnvgirgymylkgprgrivttniylnstlymgtk
    fiikkyasgnkdnivrnndrvyinvvvknkeyrlatnasqagvekilsaveipdvgnlsq
    vvvmksendqgirnkckmnlqdnngndigfigfhqfnniaklvasnwynrqigkasrtfg
    cswefipvddgwgessl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mk8B (B:)
    kyncilnikyemdrdklvdssgyrsrinigtgvkfseidknqvqlsnlesskievilnng
    viynsmyenfstsfwiripkyfrninneykiiscmqnnsgwevslnfsnmnskiiwtlqd
    tegikktvvfqytqninisdyinrwifvtitnnrlsnskiyingrlineesisdlgniha
    snnimfkldgcrdphryiwikyfnlfdkelnkkeikdlydnqsnsgilkdfwgdylqydk
    pyymlnlydpnkyldvnnvgirgymylkgprgrivttniylnstlymgtkfiikkyasgn
    kdnivrnndrvyinvvvknkeyrlatnasqagvekilsaveipdvgnlsqvvvmksenkc
    kmnlqdnngndigfigfhqfnniaklvasnwynrqigkasrtfgcswefipvddgwgess