PDB entry 5mk6

View 5mk6 on RCSB PDB site
Description: Crystal structure of the receptor-binding domain of botulinum neurotoxin A1 (crystal form 1)
Class: toxin
Keywords: bacterial, toxin, Toxin receptor binding domain, jelly roll fold, beta trefoil fold
Deposited on 2016-12-02, released 2018-03-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Botulinum neurotoxin type A
    Species: Clostridium botulinum [TaxId:1491]
    Gene: botA, atx, bna
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5mk6a1, d5mk6a2
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mk6A (A:)
    mhhhhhhkniintsilnlryesnhlidlsryaskinigskvnfdpidknqiqlfnlessk
    ievilknaivynsmyenfstsfwiripkyfnsislnneytiincmennsgwkvslnygei
    iwtlqdtqeikqrvvfkysqminisdyinrwifvtitnnrlnnskiyingrlidqkpisn
    lgnihasnnimfkldgcrdthryiwikyfnlfdkelnekeikdlydnqsnsgilkdfwgd
    ylqydkpyymlnlydpnkyvdvnnvgirgymylkgprgsvmttniylnsslyrgtkfiik
    kyasgnkdnivrnndrvyinvvvknkeyrlatnasqagvekilsaleipdvgnlsqvvvm
    kskndqgitnkckmnlqdnngndigfigfhqfnniaklvasnwynrqierssrtlgcswe
    fipvddgwgerpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mk6A (A:)
    iintsilnlryesnhlidlsryaskinigskvnfdpidknqiqlfnlesskievilknai
    vynsmyenfstsfwiripkyfnsislnneytiincmennsgwkvslnygeiiwtlqdtqe
    ikqrvvfkysqminisdyinrwifvtitnnrlnnskiyingrlidqkpisnlgnihasnn
    imfkldgcrdthryiwikyfnlfdkelnekeikdlydnqsnsgilkdfwgdylqydkpyy
    mlnlydpnkyvdvnnvgirgymylkgprgsvmttniylnsslyrgtkfiikkyasgnkdn
    ivrnndrvyinvvvknkeyrlatnasqagvekilsaleipdvgnlsqvvvmkskndqgit
    nkckmnlqdnngndigfigfhqfnniaklvasnwynrqierssrtlgcswefipvddgwg
    e