PDB entry 5mje

View 5mje on RCSB PDB site
Description: Crystal structure of the HigB2 toxin in complex with Nb8
Class: toxin
Keywords: toxin-antitoxin system, toxin
Deposited on 2016-11-30, released 2017-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-17, with a file datestamp of 2017-05-12.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytotoxic translational repressor of toxin-antitoxin stability system
    Species: Vibrio cholerae [TaxId:666]
    Gene: EN12_16040, ERS013138_03879, ERS013140_03929, ERS013166_04476, ERS013173_04173, ERS013186_03907, ERS013199_03648, ERS013200_04302, ERS013207_03773
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A085RXT0 (19-128)
      • expression tag (11-18)
  • Chain 'B':
    Compound: Nanobody 8
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MJE
    Domains in SCOPe 2.07: d5mjeb1, d5mjeb2
  • Heterogens: PEG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >5mjeB (B:)
aqvqlqesggglvqpggslrlscvvsgdrrtiytmgwfrqapgnqgelvatmtssgvtty
vdsvkgrfsisrdsaedsakntvslqmnslkpedtafytcyeesrrplgsrntywgqgtq
vtvsshhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >5mjeB (B:)
qvqlqesggglvqpggslrlscvvsgdrrtiytmgwfrqapgnqgelvatmtssgvttyv
dsvkgrfsisrdsaedsakntvslqmnslkpedtafytcyeesrrplgsrntywgqgtqv
tvss