PDB entry 5mj6

View 5mj6 on RCSB PDB site
Description: Ligand-induced conformational change of Insulin-regulated aminopeptidase: insights on catalytic mechanism and active site plasticity.
Class: hydrolase
Keywords: Insulin-regulated aminopeptidase, Endoplasmatic Reticulum Aminopeptidases, generation of antigenic peptides for cross-presentation, phosphinic pseudotripeptides, ligand-induced conformational changes, Hydrolase
Deposited on 2016-11-30, released 2017-04-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-04-05, with a file datestamp of 2017-03-31.
Experiment type: XRAY
Resolution: 2.53 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Leucyl-cystinyl aminopeptidase
    Species: Homo sapiens [TaxId:9606]
    Gene: LNPEP, OTASE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UIQ6 (Start-870)
      • expression tag (871-880)
    Domains in SCOPe 2.06: d5mj6a1, d5mj6a2, d5mj6a3, d5mj6a4, d5mj6a5
  • Chain 'B':
    Compound: Leucyl-cystinyl aminopeptidase
    Species: Homo sapiens [TaxId:9606]
    Gene: LNPEP, OTASE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UIQ6 (Start-870)
      • expression tag (871-880)
    Domains in SCOPe 2.06: d5mj6b1, d5mj6b2, d5mj6b3, d5mj6b4, d5mj6b5
  • Heterogens: NAG, BMA, MAN, ZN, 7O2, BR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mj6A (A:)
    atngklfpwaqirlptavvplryelslhpnltsmtfrgsvtisvqalqvtwniilhstgh
    nisrvtfmsavssqekqaeileyayhgqiaivapeallaghnytlkieysanisssyygf
    ygfsytdesnekkyfaatqfeplaarsafpcfdepafkatfiikiirdeqytalsnmpkk
    ssvvlddglvqdefsesvkmstylvafivgemknlsqdvngtlvsiyavpekigqvhyal
    ettvklleffqnyfeiqyplkkldlvaipdfeagamenwglltfreetllydsntssmad
    rklvtkiiahelahqwfgnlvtmkwwndlwlnegfatfmeyfslekifkelssyedflda
    rfktmkkdslnsshpisssvqsseqieemfdslsyfkgsslllmlktylsedvfqhavvl
    ylhnhsyasiqsddlwdsfnevtnqtldvkrmmktwtlqkgfplvtvqkkgkelfiqqer
    fflnmkpeiqpsdtsylwhiplsyvtegrnyskyqsvslldkksgvinlteevlwvkvni
    nmngyyivhyadddwealihqlkinpyvlsdkdranlinnifelaglgkvplkrafdlin
    ylgnenhtapitealfqtdliynlleklgymdlasrlvtrvfkllqnqiqqqtwtdegtp
    smrelrsallefacthnlgncsttamklfddwmasngtqslptdvmttvfkvgaktdkgw
    sfllgkyisigseaeknkilealassedvrklywlmksslngdnfrtqklsfiirtvgrh
    fpghllawdfvkenwnklvqkfplgsytiqnivagstylfstkthlsevqaffenqseat
    frlrcvqealeviqlniqwmeknlksltwwlrtetsqvapa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mj6A (A:)
    ngklfpwaqirlptavvplryelslhpnltsmtfrgsvtisvqalqvtwniilhstghni
    srvtfmsavssqekqaeileyayhgqiaivapeallaghnytlkieysanisssyygfyg
    fsytdesnekkyfaatqfeplaarsafpcfdepafkatfiikiirdeqytalsnmpkkss
    vvlddglvqdefsesvkmstylvafivgemknlsqdvngtlvsiyavpekigqvhyalet
    tvklleffqnyfeiqyplkkldlvaipdfeagamenwglltfreetllydsntssmadrk
    lvtkiiahelahqwfgnlvtmkwwndlwlnegfatfmeyfslekifkelssyedfldarf
    ktmkkdslnsshpisssvqsseqieemfdslsyfkgsslllmlktylsedvfqhavvlyl
    hnhsyasiqsddlwdsfnevtnqtldvkrmmktwtlqkgfplvtvqkkgkelfiqqerff
    lnmsylwhiplsyvtegrnyskyqsvslldkksgvinlteevlwvkvninmngyyivhya
    dddwealihqlkinpyvlsdkdranlinnifelaglgkvplkrafdlinylgnenhtapi
    tealfqtdliynlleklgymdlasrlvtrvfkllqnqiqqqtwtdegtpsmrelrsalle
    facthnlgncsttamklfddwmasngtqslptdvmttvfkvgaktdkgwsfllgkyisig
    seaeknkilealassedvrklywlmksslngdnfrtqklsfiirtvgrhfpghllawdfv
    kenwnklvqkfplgsytiqnivagstylfstkthlsevqaffenqseatfrlrcvqeale
    viqlniqwmeknlksltwwlrtetsqvapa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5mj6B (B:)
    atngklfpwaqirlptavvplryelslhpnltsmtfrgsvtisvqalqvtwniilhstgh
    nisrvtfmsavssqekqaeileyayhgqiaivapeallaghnytlkieysanisssyygf
    ygfsytdesnekkyfaatqfeplaarsafpcfdepafkatfiikiirdeqytalsnmpkk
    ssvvlddglvqdefsesvkmstylvafivgemknlsqdvngtlvsiyavpekigqvhyal
    ettvklleffqnyfeiqyplkkldlvaipdfeagamenwglltfreetllydsntssmad
    rklvtkiiahelahqwfgnlvtmkwwndlwlnegfatfmeyfslekifkelssyedflda
    rfktmkkdslnsshpisssvqsseqieemfdslsyfkgsslllmlktylsedvfqhavvl
    ylhnhsyasiqsddlwdsfnevtnqtldvkrmmktwtlqkgfplvtvqkkgkelfiqqer
    fflnmkpeiqpsdtsylwhiplsyvtegrnyskyqsvslldkksgvinlteevlwvkvni
    nmngyyivhyadddwealihqlkinpyvlsdkdranlinnifelaglgkvplkrafdlin
    ylgnenhtapitealfqtdliynlleklgymdlasrlvtrvfkllqnqiqqqtwtdegtp
    smrelrsallefacthnlgncsttamklfddwmasngtqslptdvmttvfkvgaktdkgw
    sfllgkyisigseaeknkilealassedvrklywlmksslngdnfrtqklsfiirtvgrh
    fpghllawdfvkenwnklvqkfplgsytiqnivagstylfstkthlsevqaffenqseat
    frlrcvqealeviqlniqwmeknlksltwwlrtetsqvapa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mj6B (B:)
    lfpwaqirlptavvplryelslhpnltsmtfrgsvtisvqalqvtwniilhstghnisrv
    tfmsavssqekqaeileyayhgqiaivapeallaghnytlkieysanisssyygfygfsy
    tdesnekkyfaatqfeplaarsafpcfdepafkatfiikiirdeqytalsnmpkkssvvl
    ddglvqdefsesvkmstylvafivgemknlsqdvngtlvsiyavpekigqvhyalettvk
    lleffqnyfeiqyplkkldlvaipdfeagamenwglltfreetllydsntssmadrklvt
    kiiahelahqwfgnlvtmkwwndlwlnegfatfmeyfslekifkelssyedfldarfktm
    kkdslnsshpisssvqsseqieemfdslsyfkgsslllmlktylsedvfqhavvlylhnh
    syasiqsddlwdsfnevtnqtldvkrmmktwtlqkgfplvtvqkkgkelfiqqerfflns
    ylwhiplsyvtegrnyskyqsvslldkksgvinlteevlwvkvninmngyyivhyadddw
    ealihqlkinpyvlsdkdranlinnifelaglgkvplkrafdlinylgnenhtapiteal
    fqtdliynlleklgymdlasrlvtrvfkllqnqiqqqtwtdegtpsmrelrsallefact
    hnlgncsttamklfddwmasngtqslptdvmttvfkvgaktdkgwsfllgkyisigseae
    knkilealassedvrklywlmksslngdnfrtqklsfiirtvgrhfpghllawdfvkenw
    nklvqkfplgsytiqnivagstylfstkthlsevqaffenqseatfrlrcvqealeviql
    niqwmeknlksltwwlrtetsqvapa