PDB entry 5mht

View 5mht on RCSB PDB site
Description: ternary structure of hhai methyltransferase with hemimethylated DNA and adohcy
Class: transferase/DNA
Keywords: transferase, methyltransferase, restriction system, complex (methyltransferase/DNA)
Deposited on 1996-10-22, released 1997-07-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.188
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (hhai methyltransferase)
    Species: Haemophilus haemolyticus [TaxId:726]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d5mhta_
  • Chain 'C':
    Compound: DNA (5'-d(*cp*cp*ap*tp*gp*(5cm)p*gp*cp*tp*gp*ap*c)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*gp*tp*cp*ap*gp*cp*gp*cp*ap*tp*gp*g)-3')
  • Heterogens: SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5mhtA (A:)
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.