PDB entry 5mhg

View 5mhg on RCSB PDB site
Description: Crystal structure of anti-T4 Fab fragment with tetraiodoBPA
Class: immune system
Keywords: Fab-fragment, Ig fold, IMMUNE SYSTEM
Deposited on 2016-11-24, released 2018-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab-Fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MHG (0-End)
  • Chain 'L':
    Compound: Fab-Fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MHG (0-212)
    Domains in SCOPe 2.07: d5mhgl1, d5mhgl2
  • Heterogens: SO4, 4IB

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5mhgL (L:)
    divlnqspaimsaspgekvtmtcnssssvsymhwyqhkpgssprlliydtsnlasgvpar
    fsgsgsgtsysltisrmeaedaatyycqqrssypltfgagtkleitradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec