PDB entry 5mhb

View 5mhb on RCSB PDB site
Description: Product-Complex of E.coli 5-Amino Laevulinic Acid Dehydratase
Class: lyase
Keywords: Dehydratase, Lyase, Tetrapyrrole Biosynthesis
Deposited on 2016-11-23, released 2016-12-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-12-07, with a file datestamp of 2016-12-02.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: delta-aminolevulinic acid dehydratase
    Species: Escherichia coli [TaxId:562]
    Gene: hemB, ncf, b0369, JW0361
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5mhba_
  • Heterogens: PBG, ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mhbA (A:)
    mtdliqrprrlrkspalramfeettlslndlvlpifveeeiddykaveampgvmripekh
    lareierianagirsvmtfgishhtdetgsdawredglvarmsrickqtvpemivmsdtc
    fceytshghcgvlcehgvdndatlenlgkqavvaaaagadfiapsaamdgqvqairqald
    aagfkdtaimsystkfassfygpfreaagsalkgdrksyqmnpmnrreaireslldeaqg
    adclmvkpagayldivrelrertelpigayqvsgeyamikfaalagaideekvvleslgs
    ikragadlifsyfaldlaekkilr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mhbA (A:)
    tdliqrprrlrkspalramfeettlslndlvlpifveeeiddykaveampgvmripekhl
    areierianagirsvmtfgishhtdetgsdawredglvarmsrickqtvpemivmsdtcf
    ceytshghcgvlcehgvdndatlenlgkqavvaaaagadfiapsaamdgqvqairqalda
    agfkdtaimsystkfassfygpfreaagsalkgdrksyqmnpmnrreaireslldeaqga
    dclmvkpagayldivrelrertelpigayqvsgeyamikfaalagaideekvvleslgsi
    kragadlifsyfaldlaekkilr