PDB entry 5mgk

View 5mgk on RCSB PDB site
Description: Crystal Structure of BAZ2A bromodomain in complex with 4-propionyl-pyrrole derivative 2
Class: transcription
Keywords: four helical bundle, transcription
Deposited on 2016-11-21, released 2017-04-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain adjacent to zinc finger domain protein 2A
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2A, KIAA0314, TIP5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5mgka_
  • Heterogens: 7MW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5mgkA (A:)
smhsdltfceiilmemeshdaawpflepvnprlvsgyrriiknpmdfstmrerllrggyt
sseefaadallvfdncqtfneddsevgkaghimrrffesrweefy

    Sequence, based on observed residues (ATOM records): (download) 
    >5mgkA (A:)
hsdltfceiilmemeshdaawpflepvnprlvsgyrriiknpmdfstmrerllrggytss
eefaadallvfdncqtfneddsevgkaghimrrffesrweefy