PDB entry 5mgi

View 5mgi on RCSB PDB site
Description: Crystal structure of KPC-2 carbapenemase in complex with a phenyl boronic inhibitor.
Class: hydrolase
Keywords: carbapenemase, beta-lactamase, phenyl boronic inhibitor, hydrolase
Deposited on 2016-11-21, released 2018-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbapenem-hydrolyzing beta-lactamase KPC
    Species: Klebsiella oxytoca [TaxId:571]
    Gene: bla, kpc, kpc2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mgia_
  • Heterogens: 6YV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5mgiA (A:)
    tnlvaepfakleqdfggsigvyamdtgsgatvsyraeerfplcssfkgflaaavlarsqq
    qaglldtpirygknalvpwspisekylttgmtvaelsaaavqysdnaaanlllkelggpa
    gltafmrsigdttfrldrwelelnsaipgdardtsspravteslqkltlgsalaapqrqq
    fvdwlkgnttgnhriraavpadwavgdktgtcgvygtandyavvwptgrapivlavytra
    pnkddkhseaviaaaarlaleglg