PDB entry 5mcj

View 5mcj on RCSB PDB site
Description: Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 14.1 MGy
Class: hydrolase
Keywords: Glycoside hydrolase, Cellobiohydrolase, radiation damage, hydrolase
Deposited on 2016-11-09, released 2017-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-01-11, with a file datestamp of 2017-01-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellobiohydrolase CHBI
    Species: Daphnia pulex [TaxId:6669]
    Gene: CEL7A, DAPPUDRAFT_347598
    Database cross-references and differences (RAF-indexed):
    • Uniprot E9G5J5 (0-444)
      • engineered mutation (0)
    Domains in SCOPe 2.06: d5mcja_
  • Chain 'B':
    Compound: Cellobiohydrolase CHBI
    Species: Daphnia pulex [TaxId:6669]
    Gene: CEL7A, DAPPUDRAFT_347598
    Database cross-references and differences (RAF-indexed):
    • Uniprot E9G5J5 (0-444)
      • engineered mutation (0)
    Domains in SCOPe 2.06: d5mcjb_
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mcjA (A:)
    envgtqaaeeplnlpisvctapgncqteadavvldsnwrwahtttgytncytgnlwdttl
    cptpetcttncaidgvpladwsgtyggsvtgnkfnlkfvtvgpystnigartflldstkt
    ryrmfqllnreftydvdvssldcglngalyfvsmdadggaakyptnkggakygtgycdaq
    cphdvkwinglanskdwtpipgdansgkgyygnccaeldiweankqsqaftthpctpndq
    trcegvvcgdndsgdryngmcdkdgcdfasyrmndhtfygpgstfkldstkpftvvsqfi
    ttdgtdngdfkefrrfyvqngvrienskvnfpgitaydsitdemcaatkglfgdlddhkn
    kggmkqmgeamrkgmalvmsiwddhdvnmlwldsnypptgnpstpgvargpcpttsgvps
    evevtqanavvsfgnikfgpigstv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mcjA (A:)
    envgtqaaeeplnlpisvctapgncqteadavvldsnwrwahtttgytncytgnlwdttl
    cptpetcttncaidgvpladwsgtyggsvtgnkfnlkfvtvstnigartflldstktryr
    mfqllnreftydvdvssldcglngalyfvsmdadggaakyptnkggakygtgycdaqcph
    dvkwinglanskdwtpipgdansgkgyygnccaeldiweankqsqaftthpctpndqtrc
    egvvcgdndsgdryngmcdkdgcdfasyrmndhtfygpgstfkldstkpftvvsqfittd
    gtdngdfkefrrfyvqngvrienskvnfpgitaydsitdemcaatkglfgdlddhknkgg
    mkqmgeamrkgmalvmsiwddhdvnmlwldsnypptgnpstpgvargpcpttsgvpseve
    vtqanavvsfgnikfgpigstv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5mcjB (B:)
    envgtqaaeeplnlpisvctapgncqteadavvldsnwrwahtttgytncytgnlwdttl
    cptpetcttncaidgvpladwsgtyggsvtgnkfnlkfvtvgpystnigartflldstkt
    ryrmfqllnreftydvdvssldcglngalyfvsmdadggaakyptnkggakygtgycdaq
    cphdvkwinglanskdwtpipgdansgkgyygnccaeldiweankqsqaftthpctpndq
    trcegvvcgdndsgdryngmcdkdgcdfasyrmndhtfygpgstfkldstkpftvvsqfi
    ttdgtdngdfkefrrfyvqngvrienskvnfpgitaydsitdemcaatkglfgdlddhkn
    kggmkqmgeamrkgmalvmsiwddhdvnmlwldsnypptgnpstpgvargpcpttsgvps
    evevtqanavvsfgnikfgpigstv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mcjB (B:)
    envgtqaaeeplnlpisvctapgncqteadavvldsnwrwahtttgytncytgnlwdttl
    cptpetcttncaidgvpladwsgtyggsvtgnkfnlkfvtvtnigartflldstktryrm
    fqllnreftydvdvssldcglngalyfvsmdadggaakyptnkggakygtgycdaqcphd
    vkwinglanskdwtpipgdansgkgyygnccaeldiweankqsqaftthpctpndqtrce
    gvvcgdndsgdryngmcdkdgcdfasyrmndhtfygpgstfkldstkpftvvsqfittdg
    tdngdfkefrrfyvqngvrienskvnfpgitaydsitdemcaatkglfgdlddhknkggm
    kqmgeamrkgmalvmsiwddhdvnmlwldsnypptgnpstpgvargpcpttsgvpsevev
    tqanavvsfgnikfgpigstv