PDB entry 5mcb

View 5mcb on RCSB PDB site
Description: Glycogen phosphorylase in complex with chlorogenic acid.
Class: transferase
Keywords: alpha and beta protein, transferase
Deposited on 2016-11-09, released 2017-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen phosphorylase, muscle form
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mcba_
  • Heterogens: PLP, CGG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mcbA (A:)
    qisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwirtq
    qhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieedagl
    gngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpwek
    arpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakapnd
    fnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrf
    ksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvkt
    caytnhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslv
    eegavkrinmahlciagshavngvarihseilkktifkdfyelephkfqnktngitprrw
    lvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaayler
    eykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaap
    gyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagt
    easgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqey
    ydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsaly
    knprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mcbA (A:)
    qisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwirtq
    qhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieedagl
    gngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpwek
    arpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakapnd
    fnlgyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkssnfd
    afpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvlpealerw
    pvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahlcia
    gshavngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiiaeri
    geeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfdvqv
    kriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklitaig
    dvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmlngal
    tigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieqlss
    gffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirniat
    sgkfssdrtiaqyareiwgvepsrqrlpa