PDB entry 5mb2

View 5mb2 on RCSB PDB site
Description: Structure of sucrose phosphorylase from Bifidobacterium adolescentis bound to nigerose
Class: transferase
Keywords: sucrose phosphorylase, resveratrol, enzyme design, transferase
Deposited on 2016-11-07, released 2017-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: sucrose phosphorylase
    Species: Bifidobacterium adolescentis [TaxId:1680]
    Gene: sucP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84HQ2 (0-503)
      • conflict (344)
    Domains in SCOPe 2.07: d5mb2b1, d5mb2b2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5mb2B (B:)
    mknkvqlityadrlgdgtiksmtdilrtrfdgvydgvhilpfftpfdgadagfdpidhtk
    vderlgswddvaelskthnimvdaivnhmsweskqfqdvlakgeeseyypmfltmssvfp
    ngateedlagiyrprpglpfthykfagktrlvwvsftpqqvdidtdsdkgweylmsifdq
    maashvsyirldavgygakeagtscfmtpktfklisrlreegvkrgleilievhsyykkq
    veiaskvdrvydfalpplllhalstghvepvahwtdirpnnavtvldthdgigvidigsd
    qldrslkglvpdedvdnlvntihanthgesqaatgaaasnldlyfvnstyysalgcndqh
    yiaaravqfflpgvpqvyyvgalagkndmellrktnngrdinrhyystaeidenlkrpvv
    kalnalakfrneldafdgtfsyttdddtsisftwrgetsqatltfepkrglgvdnttpva
    mlewedsagdhrsddlianppvva